KEGG   Corallococcus coralloides: COCOR_04151Help
Entry
COCOR_04151       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ccx  Corallococcus coralloides
Pathway
ccx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    COCOR_04151
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ccx02044]
    COCOR_04151
Secretion system [BR:ccx02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   COCOR_04151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF_C ImcF-related_N AAA_16
Motif
Other DBs
NCBI-ProteinID: AFE05669
UniProt: H8MXE4
Position
5168548..5172369
Genome map
AA seq 1273 aa AA seqDB search
MGALQSMLAALKAHWVLVLGIVVVLAAIGVGVTLWWRKRQQRGPALGSEQKPLGSGQLLA
IRKQFLAKLPWRFRASVRDFPTLVVLGPAGSGKSDLIEAEVDWERQQRQFMPSYTDDPLL
KVFLGPEVVVQELAAPVLEDDSLHARRALRRLWKATFGRRHVGRAVIVLKVNWLLETSPD
EVKRVTQLLRGKVNLLSEVCQSPVETRLVLTHMDTLDGYADFAQLLRKNGVPLELTVPPP
GREGELGEALQPMEKYLALGLTSLSPDAFERLASFYSRGGEAFAALGRFVSTLLEGGSLA
YPLKLQRVFLSSGGADAQPTGALAVQADQPAEVLVRDYRWTHLRRCAVILAVGCLPVLLA
YAHFYRLLLRAQDKLDAFQVTVQRLEERNQSVSGSVVESQTGDAVKAMEDLWSATRYWPP
LEHSFTDEWAELRARLARSIRMSYLKPMLEKCQDQCRRCPGQIPGCQPAPAFANRGTRAT
PLVPAPSADDSCHMETLCRPEQVLYTLGVLYASRNEDLGQFVLRSVHGTHKKQLGWTAEA
FGLSLASTDQEHNWLEAMGLAEPMIANYVIASDKPFDENVPWTRWPFAWLTMDGLLGPWR
DHFMQLQETLSAKELDLARWRALADDRERLRASLAESAPYSSARKVMDLINASDAEPDAS
QLKGVGSLLDSLDWLRQNRQTLEAILRMEDETDAALRAAARMTPAELLTRADGLFAPSDG
DARYQVEVLRRDFEFRPMDVSRQLLDKVLRSLKETGRTPFNADSFNPRAGETTSEVATEG
AGDDDTEFTSGTAPVVGKVLGKAAFEAQLSPLVDEFTERLAKSSLSREEAVERATFVQGK
VQTFAKRYGQDLYATYRGYRFRTTPRGSLASDLSVLLQPSSPLEAMLRDVAVRASVGPLE
SEYYAPMRDAVAPFKPVVQLMTPDKSGVLVELAAYTTLVSQLQQELSGAKPAAAKPAAPN
AAPGAAGATVSSAGSQLAEMLTPVGRVALSMLLEEEDSYLRRVDAWLDQHGLVGEFRQPF
RQPFIIVRNRGRAELERLIAEQWTYQARRTLDPLVKRYPFNPSASQEVDPVELEVLRRKD
GAFWGFVTQVLAPVVEERGTDWTLRYPLKSRLLLPPRMLSALGQLGRLSKLLWDDEGKPR
PIPMQVRPLPLPSAPTPDSFVTLSYLKCGGAASFGFNQRPAWGEFPLSWWSPQPSSIGVE
LRSPQRDGKRYRSMEMSESSWNCFRLLESATLTDQSNVVWVLPGRGLAANEKVLEISFGL
RGEPWAPFRGVVP
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgcgctccagtccatgctggcggccttgaaggcccactgggtgctcgtgctgggc
atcgtggtggtgctcgcggccattggcgtgggcgtgacgctgtggtggcgcaagcggcag
cagcgcggcccggcgctcgggagcgagcagaagccgctcgggtcgggacagctgctggcc
atccgcaagcagttcctggcgaagctgccgtggcgcttccgcgcgtccgtgcgggacttc
cccacgctggtggtgctgggtccggcgggcagcggcaagtcggacctcatcgaagcggag
gtggactgggagcggcagcagcgccagttcatgcccagctacacggacgacccgctcctc
aaggtgttcctggggccggaggtcgtggtgcaggagctggccgcgcccgtgctggaggac
gactcgctccatgcgcggcgcgcgctgcgcaggttgtggaaggccaccttcgggcgccgg
cacgtgggccgggccgtcatcgtcctgaaggtcaactggctgctggagacgtctccggac
gaggtgaagcgcgtcacccagctcttgcgcggcaaggtcaacctcctgtcggaggtgtgc
cagtcgcccgtggagacgcggctggtcctcacgcacatggacacgctggacggctacgcg
gatttcgcgcagctgctccggaagaacggcgtgccgctggagctgacggttccgccgccc
ggcagggaaggggagctgggcgaagcgctccagcccatggagaagtacctggcgctgggc
ctcacctcgctgtcgccggacgcgttcgagcggctggcgtcgttctactctcgcggcgga
gaggccttcgcggcgctgggtcgcttcgtgtccacgctgctggagggcggctcgctggcg
tacccgctgaagctccagcgcgtgttcctgtcctcgggcggagcggatgcccagcccacg
ggcgcgctggcggtgcaggcggatcaaccggcggaggtgctcgtccgggactaccgctgg
acgcacctgcgccggtgcgcggtcatcctcgcggtggggtgcctgccggtgctgctggcg
tacgcgcacttctaccggctgctcctgcgcgcgcaggacaagctggacgcgttccaggtc
acggtgcagcggctggaggagcgcaaccagagcgtgtccggctccgtggtggagtcccag
acgggcgacgcggtgaaggcgatggaggacctctggagcgccacgcgctactggccgccc
ctggagcacagcttcaccgacgagtgggcggagctgcgggcgcggctcgcgcgcagcatc
cggatgtcctacttgaagccgatgctggagaagtgccaggaccagtgccggcgctgcccg
ggccagattcccggctgccagcccgcgcccgccttcgccaaccggggcacgcgagccacg
ccgctcgtcccggcgccctcggcggatgacagctgccacatggagacgctgtgccgtccg
gagcaggtcctctacacgctgggcgtactctacgcctcgcgcaacgaggacctgggccag
ttcgtgctgcgcagcgtgcacgggacgcacaagaagcagctcgggtggacggcggaggcc
ttcggcttgagcctggccagcaccgaccaggagcacaactggctggaggcgatgggcctg
gcggagccgatgatcgccaactacgtcatcgccagcgacaagcccttcgacgagaacgtc
ccctggacgcgctggcccttcgcctggctgaccatggacggcctgctgggcccgtggcgc
gaccacttcatgcagctgcaggagacgctgtccgcgaaggagctggacctggcccggtgg
cgcgcgctggcggacgaccgtgagcgcctgcgcgcctcgctggctgagagcgcgccgtac
agctccgcccgcaaggtgatggacctcatcaacgcgtcggacgccgagccggacgccagc
cagctgaagggcgtgggcagcctgttggactcgctggactggctgcgccagaaccgccag
acgctggaggccatcctgcgcatggaggacgaaacggacgccgccctgcgcgccgccgcc
cgcatgacgcccgcggagctgctcacccgcgcggacggcctcttcgcccccagcgacggg
gatgcgcgctaccaggtggaggtcctccggcgcgacttcgagttccgccccatggacgtg
tcgcggcagctgctggacaaggtgctgcgctcgctgaaggagacgggccgcacgccgttc
aacgcggattcgttcaacccgcgcgcgggcgagacgacgtcggaagtggcgaccgaaggg
gcgggggacgacgacacggagttcaccagcgggacggctccggtggtgggcaaggtgctg
ggcaaggccgccttcgaggcgcagctgagcccgctggtggacgagttcacggagcggctc
gccaagtccagcctgtctcgcgaggaggccgtggagcgcgccaccttcgtgcagggcaag
gtgcagaccttcgcgaagcgctacggccaggacctctacgcgacgtaccggggctaccgc
ttccgcaccacgccgcgaggctcgctggccagcgacctgtccgtgctgctgcagccgtcg
tcgccgctggaggcaatgctgcgcgacgtggcggtccgcgccagcgtgggcccgctggag
agcgagtactacgcgcccatgcgcgacgcggtggcgcccttcaagccggtggtgcagctg
atgacgccggacaagagcggcgtgctcgtggagctggcggcctacaccacgctggtgtcg
cagcttcagcaggagctgtccggcgcgaagcccgcggccgcgaagcccgccgctcccaac
gcggcgcccggggccgctggcgcgacggtgtcctcggcgggctcgcagctggcggagatg
ctgacgccggtggggcgcgtggcgctgagcatgctgctggaggaggaggactcgtacctg
cgccgggtggacgcgtggctggatcagcacggcctggtgggcgagttccggcagccgttc
cgccagcccttcatcatcgtgcgcaaccggggccgcgcggagctggagcgcctcatcgcg
gagcagtggacgtaccaggcccgccgcacgctggacccgctggtgaagcgctatccgttc
aatcccagcgcgtcgcaggaagtggatccggtggagctggaggtgctgcgccgcaaggac
ggggccttctggggcttcgtcacgcaggtgctggcgccggtggtggaggagcgcgggacg
gactggacgctgcgctatccgctgaagtcccggctgctgctgccgccgcgcatgctctcc
gcgctgggccagctgggccgcctgtcgaagctgttgtgggatgacgagggcaagccccgg
cccatccccatgcaggtgcgtccgctgccgctgccgtcggcgcccacgccggacagcttc
gtgacgctgtcgtacctgaagtgcggcggggcggcgtcgttcggcttcaaccagcggccc
gcgtggggtgagttcccgctgagctggtggagcccgcagccgtcgtccatcggcgtggag
ctgcgctcgccgcagcgggatgggaagcgctaccgctccatggagatgtccgagtcgtca
tggaactgcttccgcctgctggagtccgcgacgctgacggatcagtccaacgtggtgtgg
gtgctgccgggacgcggactggcggcgaacgagaaggttctggagatcagcttcgggttg
cgcggcgagccttgggcgccattccgtggggtggtgccatga

DBGET integrated database retrieval system