KEGG   Corallococcus coralloides: COCOR_04193Help
Entry
COCOR_04193       CDS       T01780                                 

Gene name
scoA
Definition
(GenBank) 3-oxoacid CoA-transferase subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00072  Synthesis and degradation of ketone bodies
ccx00280  Valine, leucine and isoleucine degradation
ccx00650  Butanoate metabolism
ccx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    COCOR_04193 (scoA)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    COCOR_04193 (scoA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_04193 (scoA)
Enzymes [BR:ccx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     COCOR_04193 (scoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: AFE10308
UniProt: H8MYW7
Position
5219903..5220604
Genome map
AA seq 233 aa AA seqDB search
MNKVYASADEAVADIPDNITLMSGGFGLCGNPENLITALHKKNVKGLTIISNNCGTTELG
LGILLQNKQVKKMVASYVGENKEFERQFLSGELEVELNPQGTLAERIRAGGCGIGGFFTP
TGAGTQVAEGKESRMIDGRLHVLETPLKADFAIVHAWKADTWGNLVFHKTARNFTPMMCM
AAKVTIVEAEHIVQPGELDPDQVHIPSIFVHRIVQAQNLQKWIERRTVRKKAS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtctacgcgagcgcggatgaggcggtcgccgacatcccggacaacatcact
ctcatgagtggtgggttcgggctgtgcggcaaccccgagaacctcatcacggccctgcac
aagaagaacgtgaagggcctcaccatcatctccaacaactgcggcaccacggagctgggg
ctgggcatcctcctgcagaacaagcaggtgaagaagatggtcgccagctacgtgggggag
aacaaggagttcgagcggcagttcctctccggagagctggaggtggagctcaacccgcag
ggcacgctcgcggagcgcatccgcgccgggggctgcggcatcggcgggttcttcacgccg
acgggcgcgggcacccaggtggcggagggcaaggagtcgcgcatgatcgacgggcgcctc
cacgtcctggagacgccgctgaaggcggacttcgccatcgtccacgcctggaaggcggac
acctggggcaacctggtgttccacaagacggcgcggaacttcacccccatgatgtgcatg
gccgccaaggtcaccatcgtggaggcggagcacatcgtgcagccgggtgagctggacccg
gatcaggtgcacatcccgagcatcttcgtgcaccgcatcgtgcaggcgcagaacctccag
aagtggatcgagcggcggaccgtccgcaagaaggcgtcctga

DBGET integrated database retrieval system