KEGG   Corallococcus coralloides: COCOR_05349Help
Entry
COCOR_05349       CDS       T01780                                 

Gene name
treZ1
Definition
(GenBank) 12C4-alpha-glucan
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00500  Starch and sucrose metabolism
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
Module
ccx_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCOR_05349 (treZ1)
Enzymes [BR:ccx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     COCOR_05349 (treZ1)
Exosome [BR:ccx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCOR_05349 (treZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase Alpha-amylase_C Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AFE10533
UniProt: H8MW06
Position
6732138..6735230
Genome map
AA seq 1030 aa AA seqDB search
MTDSKINRPKLSSTPATGSTTPNAAALAERQKAAAAKAAAAKRNQSGFESTPAAGARAPV
AGTGNLARSANASALLGAAPTSAVKNGATVANPTTRTITFTYDAGPHAALTNPKLKGSWD
ADGRYNAQWSSGGIPMKPLGNGKYEATVKVADDGLAHNWEWGVSVDGPSGKDQWAVMGEG
NLKLDLSKPTASYSPTTYHTMGAQKSGQDVNFKFWAPDARAVQVKVTDKEGREQRIPMTR
DEGGNWTTQAKGAWSQMEGKAYVYEVVDSTGAVSDRPDPYARRMMGEQRGLDRLYLDPTR
GKEVDRYFTGATGLMRFDIDSAEDADSAYLVLKDGDGNPLNKQQLQERLGKFDDTLIDKL
RGGKFNDFWSRNVTDDGRIKMTNQAGAWTTLVNDPDKLVGLRYEFQVFDKDAQGKLHLRD
DVNNDGKLSDVERRASTENDPWSNLITKGSGVDFRGSILTDPTTFQFKNDDVPREKDPSK
WVVYQAHVGSFMGEAGNANRSTMEDMIKKLDYFKELGVTTLELLPTNEVEGPRNWGYLGV
NSLATESSFGFEDENGQWVEGDEALKRFIDEAHGKGLNVVSDVVYNHVFGDHNGLWNVGG
PSNPYFNWSKQPGQFEQRDTPWGAVPAYNTPQVKQLFVDHAVQQIAELKFDGLRFDFTEP
IKGTGGKDGWEMLREINRQVHFLNPNAWTVAEQFDYEPDISRPAKSDGTGGGFDAQWYTE
FQHRLVRDNSKPGLIQAAARGMKTDVDAFVNLMTNPRGLDGWKHALSIISNHDEVGNAER
TLDTAEGANPTDFPDNWSRGAARFAAGIGMAGPGIPMFFQGDEFGAQNSFKWGNPSTWDS
DWSWQDIGKGVDFGKVTFNDTTKATYERLFELSPDARAKDSAYKAFSADDKKLFAEVAAL
PASERRDAMIDITRRQSFNFYKDSIGLRNSSDAFSAAAEVKRVYTHNDDSVMAFTRKSGN
EEFLVVGSLNKKNLEGYSLPLPPGQWKEVLNSDAAVYGGGNFGNYGATLNGGNTPVNIPA
GGYVVMKKVG
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
gtgactgattccaaaatcaaccgcccgaaactctcctcgacccccgccacgggtagcacc
actcccaacgccgccgcgctggccgagcggcagaaggccgccgccgcgaaggccgccgcc
gcgaagcgcaaccagtctggcttcgaatccacgcccgcggccggcgcccgcgccccggtg
gctggcaccggcaacctggcccgctccgccaacgcgagcgcgctcctgggtgccgcgccc
acgtccgcggtgaagaacggcgcgacggtggcgaaccccaccacccgcaccatcaccttc
acgtacgacgcgggcccgcacgcggcgctcaccaacccgaagctcaagggcagctgggac
gcggacggccgctacaacgcgcagtggtcctctggcggcatccccatgaagccgctgggc
aacggcaagtacgaggccacggtgaaggtggcggacgacggcctggcccataactgggag
tggggcgtcagcgtggacggcccgtccggcaaggaccagtgggcggtgatgggcgagggc
aacctcaagttggatctgtccaagcccaccgcgtcctactcgcccacgacgtaccacacg
atgggtgcgcagaagtccggccaggacgtgaacttcaagttctgggcgccggacgcgcgg
gccgtgcaggtgaaggtgacggacaaggagggccgcgagcagcgcatccccatgacgcgc
gacgagggcggcaactggaccacgcaggccaagggcgcgtggtcgcagatggagggcaag
gcctacgtctacgaagtggtggactccacgggcgccgtgagcgaccggccggacccctac
gcgcgccggatgatgggcgagcagcgcggcctggaccggctctacctggaccccacgcgc
ggcaaggaggtggaccgctacttcaccggcgccaccggcctgatgcgcttcgacatcgac
agcgcggaggacgcggacagcgcgtacctcgtcctcaaggacggcgacggcaacccgctc
aacaagcagcagctccaggagcgcctgggcaagttcgacgacaccctcatcgacaagctg
cgcggcgggaagttcaacgacttctggtcgcgcaacgtcaccgacgacggccgcatcaag
atgaccaaccaggccggcgcgtggacgacgctcgtcaacgacccggacaagctggtgggc
ctgcgctacgagttccaggtgttcgacaaggacgcgcagggcaagctgcacctgcgcgac
gacgtgaacaacgacggcaagctgtccgacgtggagcgccgggcgtccacggagaacgac
ccctggagcaacctcatcaccaagggcagcggcgtggacttccgcggctccatcctcacc
gaccccacgacgttccagttcaagaacgacgacgtcccgcgtgagaaggatccgtccaag
tgggtggtgtaccaggcccacgtgggcagcttcatgggcgaggcgggcaacgccaaccgc
tccaccatggaggacatgatcaagaagctggattacttcaaggagctgggcgtcaccacg
ctggagctgttgcccaccaacgaggtggagggcccgcgcaactggggctacctgggcgtc
aacagcctggccacggagagctccttcggcttcgaggacgagaacggccagtgggtggag
ggcgatgaggccctcaagcgcttcatcgacgaggcccacggcaagggcctgaacgtggtg
tcggacgtcgtctacaaccacgtcttcggcgaccacaacggcctgtggaacgtgggcggc
cccagcaacccctacttcaactggtccaagcagcccggccagttcgagcagcgcgacacc
ccgtggggcgccgtgcccgcgtacaacacgccgcaggtgaagcagctcttcgtggaccac
gccgtgcagcagatcgccgagctgaagttcgacggcctgcgcttcgacttcacggagccc
atcaagggcacgggcggcaaggacggctgggagatgctccgggagatcaaccgccaggtg
cacttcctcaaccccaacgcgtggaccgtggcggagcagttcgactacgagccggacatc
tcgcgcccggcgaagtcggacggcacgggcggcggcttcgacgcccagtggtacacggag
ttccagcaccggctggtgcgcgacaacagcaagccgggcctcatccaggccgccgcgcgc
gggatgaagacggacgtggatgcgttcgtgaacctgatgacgaacccgcgcggcctggac
ggctggaagcacgcgctgtccatcatctccaaccacgacgaggtggggaacgcggagcgc
accctggacaccgcggagggcgcgaaccccaccgacttcccggacaactggtcgcgcggc
gccgcccgcttcgccgccggcatcggcatggccggccccggcatccccatgttcttccag
ggtgacgagttcggcgcccagaactccttcaagtggggcaacccgtccacctgggacagc
gactggagctggcaggacatcggcaagggcgtggacttcggcaaggtgacgttcaacgac
accaccaaggccacctacgagcgcctcttcgagctgtccccggacgcgcgcgcgaaggac
agcgcgtacaaggccttctccgcggatgacaagaagctgttcgcggaagtggccgcgctg
cccgcctccgagcgccgggacgcgatgatcgacatcacccgccggcagtccttcaacttc
tacaaggactccatcggcctgcggaacagcagcgacgccttcagcgccgcggccgaggtg
aagcgcgtctacacccacaacgacgacagcgtgatggccttcacgcgcaagtcgggcaac
gaggagttcctcgtggtgggcagcctcaacaagaagaacctggagggctactcgctgccg
ctgcccccgggccagtggaaggaagtgctgaacagcgacgccgcggtgtacggcggcggc
aacttcggcaactacggcgccacgctgaacggcgggaacaccccggtgaacatccccgcc
ggcggctacgtggtgatgaagaaggtcggctag

DBGET integrated database retrieval system