KEGG   Corallococcus coralloides: COCOR_05798Help
Entry
COCOR_05798       CDS       T01780                                 

Definition
(GenBank) hypothetical protein
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
ccx  Corallococcus coralloides
Pathway
ccx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ccx00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    COCOR_05798
Enzymes [BR:ccx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     COCOR_05798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_oxidored FAD_binding_3 HI0933_like Pyr_redox GIDA ApbA
Motif
Other DBs
NCBI-ProteinID: AFE06588
UniProt: H8MGW5
Position
complement(7299192..7300733)
Genome map
AA seq 513 aa AA seqDB search
MAKKYDVVVVGSGFGGSITALRLAQAGKSVAVLERGRRYNPGQFPRDVTRADELLWRHPI
RPEARGLYDVRFLSGIGTVTASGVGGGSLVYANVHVRPDPIVFDHPRWPRGFSREALDPY
YDKVAHELDVKPFPASEPLRKRDLFQQAAKRMGRQTFDPDEAVSWTEPSAPGRKACQRCA
ECEFGCQYGAKNTLDLTYLARAEKLGATVWPGLSVSHVQRVAGGYRVHFKDLATGEKTSV
EGSRVVLSAGALGTVEILLRSRDRTRTLPLVSDWLGRGYSGNGDFLGSLHGSREEILPWE
GPDVATVMRFFDAAPRFTMVTATFNRPATAVLAGMGQPQLGLLGGVGAPLWPKLWPLMHG
AFAKGLFSKPLGTGVDPARTSNLFAIGQDNANGHMVLKGDRLDIEWDYANENVALVNRMT
SAMQELASQYGGTFAPLVTWELFRRPFTVHSLGGAHLAESPARGVVSTEGEVFNYPGLYV
ADGSVIPTSIGFHPVMTISAVAERIAEAVAHGF
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagtatgacgtggtggtggtgggttccggcttcggtggttccatcaccgcg
ctccggctcgcgcaggcgggcaaatccgtggcggtgctggagcggggccgccggtacaac
ccgggccagttcccccgggacgtcacgcgcgcggacgagctgctctggcgccatcccatc
cgtccggaggcgcgcgggctctacgacgtgcgcttcctgtccggcatcggcacggtgacg
gcgagcggcgtgggcggcgggtcgctcgtctacgccaacgtccacgtgcggccggatccc
atcgtcttcgaccacccgcgttggccccggggcttcagccgcgaggcgctggacccgtac
tacgacaaggtggcgcacgagctggacgtgaagccgttccccgcgtccgagccgttgagg
aagcgcgacctgttccagcaggccgcgaagcgcatgggccgtcagaccttcgacccggac
gaggccgtgtcctggacggagccctccgccccgggccgcaaggcgtgccagcgctgcgcg
gagtgcgagttcggctgccagtacggcgcgaagaacaccctggacctcacctacctggcg
cgagcggagaagctgggcgccacggtgtggccgggcctgtccgtgtcccacgtgcagcgc
gtggcgggcggctaccgggtgcacttcaaggacctggccaccggggagaagacgtccgtg
gagggcagccgcgtggtgctgtccgccggggcgctgggcacggtggagattctgctgcgc
agccgcgaccggacccgcacgctgccgctggtgagcgattggctgggcaggggctactcc
ggcaacggcgacttcctgggctcgctgcacggcagccgcgaggagattctcccgtgggag
ggccctgacgtggccacggtgatgcgcttcttcgacgccgcgccgcgcttcaccatggtg
acggccacgttcaaccggccggcgacggcggtgctcgcggggatggggcagccgcagctg
ggcctgctgggcggcgtgggggccccgttgtggccgaagctgtggccgctcatgcacggc
gcgttcgccaaggggctgttcagcaagccgctgggcaccggcgtggatccggcgcgcacg
agcaacctgttcgccattggccaggacaatgccaatggacacatggtgctcaagggcgac
cggctggacatcgagtgggactacgcgaacgagaacgtggcgctggtgaaccgcatgact
tccgcgatgcaggagctggcctcgcagtacggcgggacgttcgcgccgctcgtcacgtgg
gagctgttccgccggccgttcacggtgcactcgctgggcggggcgcacctggcggagtcg
ccggcccgaggcgtcgtgtcgacggagggcgaagtgttcaactaccccggactgtacgtg
gcggatggctccgtcatccccacgtccatcggtttccatccggtgatgaccatcagcgcg
gtggccgagcgcatcgcggaggcggtggcccatggcttttga

DBGET integrated database retrieval system