KEGG   Corallococcus coralloides: COCOR_06717Help
Entry
COCOR_06717       CDS       T01780                                 

Definition
(GenBank) Acetyl-CoA Acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00071  Fatty acid degradation
ccx00072  Synthesis and degradation of ketone bodies
ccx00280  Valine, leucine and isoleucine degradation
ccx00310  Lysine degradation
ccx00362  Benzoate degradation
ccx00380  Tryptophan metabolism
ccx00620  Pyruvate metabolism
ccx00630  Glyoxylate and dicarboxylate metabolism
ccx00640  Propanoate metabolism
ccx00650  Butanoate metabolism
ccx00900  Terpenoid backbone biosynthesis
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01130  Biosynthesis of antibiotics
ccx01200  Carbon metabolism
ccx01212  Fatty acid metabolism
ccx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    COCOR_06717
   00630 Glyoxylate and dicarboxylate metabolism
    COCOR_06717
   00640 Propanoate metabolism
    COCOR_06717
   00650 Butanoate metabolism
    COCOR_06717
  09103 Lipid metabolism
   00071 Fatty acid degradation
    COCOR_06717
   00072 Synthesis and degradation of ketone bodies
    COCOR_06717
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCOR_06717
   00310 Lysine degradation
    COCOR_06717
   00380 Tryptophan metabolism
    COCOR_06717
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    COCOR_06717
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    COCOR_06717
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    COCOR_06717
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccx04147]
    COCOR_06717
Enzymes [BR:ccx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     COCOR_06717
Exosome [BR:ccx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   COCOR_06717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Dimer_Tnp_hAT
Motif
Other DBs
NCBI-ProteinID: AFE07088
UniProt: H8MXU9
Position
complement(8440266..8441768)
Genome map
AA seq 500 aa AA seqDB search
MKDANRIPVIVGVGQINDRPEDPLRGLDSLGLMEAALRAADADAGGGWLSRLDSLAVVDQ
LSFQQMGPLPLALAERLGARPRLHEQTAEANGDSPVRLLHEAANRIASGAVEVAAVVGGE
ALRTAARRAALAAGDAPSAHNAATRIGVQAHAAYRKRYGLNSPVDVYPLYENAGRAAYGQ
TLAEAQRESGEIWSRFSQVAAGNPGAWIREPLSVDEIVTPSPSNRPIAFPYWKRMVANSA
VNQGAGFLVTSLANALARGVPEDRLVYVGRGAAAHEPEDFLARDGYASSPSMAVSLRRTL
ELNGLTVDMLDFVELYSCFPCVPKMARRVLGWPLEKSATVFGGLTFGGGPIANYMSHVVV
SMVQRLREQGRHGLLFGNGGFATYNHSLVLTREPPPAGTLPQSFEHQAEADAARGPVPPF
VEDFMGPGRIETYTVLYERDGSPRFGVIVGRGASGERFLAKVPAQDTAGIDFLCDGKEEP
VGTEGHAVAGPGGDILWRRI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgcgaaccggattcccgtcatcgtgggcgtggggcagatcaacgaccggccg
gaggatccgctgcggggcctggattcactgggcttgatggaggccgcgctgcgagcggcg
gacgcggatgcaggcggtgggtggctctcccggctggattcgctggcggtggtggatcag
ctctcgttccagcagatggggccgttgccgctcgcgctggcggagcggctgggcgcccgg
ccgcgccttcatgaacagacggcggaggccaacggggacagcccggtgcggctgctccat
gaggccgccaaccgcatcgcctccggggcggtggaggtcgcggcggtcgtgggcggtgag
gccctgcgcacggcggcccggcgcgcggcgctggcggcgggagatgcaccctccgcgcac
aacgcagcgacccgcattggcgtccaggcgcacgcggcctaccggaagcgctacggcctc
aactcgccggtcgacgtctatcccctctatgagaacgcgggccgtgccgcgtatgggcag
acattggcggaggcgcagcgggagagtggcgaaatctggtcgcggttctcgcaggtcgcg
gcgggcaatccgggggcgtggatccgcgagccattgtccgtggacgagattgtcacgccc
tcgccgtccaaccggcccatcgcgtttccgtactggaagcggatggtggcgaacagcgcc
gtcaaccagggcgcgggattccttgtcaccagcctggcgaatgcgctcgcgcgcggagtg
ccggaggaccgcctcgtgtacgtgggccggggcgcggcggcgcatgagccggaggacttc
ctcgcgcgcgatggctatgcaagctcaccgagcatggccgtgtcgctgcgccgcacgctg
gagctgaatgggttgaccgtcgacatgctcgacttcgtggaactctacagctgcttcccg
tgcgtgccgaagatggcgcgccgcgtgttgggctggccgctggagaagtccgccaccgtg
ttcggcggcctcacgttcggcggtggccccatcgccaactacatgagccacgtggtggtc
agcatggtgcagcggctgcgcgagcagggacgccatggcctgctcttcggcaacggcggc
ttcgcgacgtacaaccacagtctcgtgctcacgcgcgaaccaccgcccgctggaacactg
ccccagtccttcgagcatcaggcggaagcggacgccgcgcgcggcccggtccctccgttc
gtggaggacttcatgggccccggccgcatcgagacgtacacggtgctgtacgaacgcgac
ggcagcccgaggttcggcgtcatcgtcgggcgcggggcctccggtgagcgcttcctggcg
aaggtcccggcgcaggacaccgcgggcatcgacttcctgtgcgacgggaaggaggagccc
gtcggcacggaagggcacgccgtcgccggacccggaggggacatcctctggcgccggatc
tag

DBGET integrated database retrieval system