KEGG   Corallococcus coralloides: COCOR_07034Help
Entry
COCOR_07034       CDS       T01780                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ccx  Corallococcus coralloides
Pathway
ccx00620  Pyruvate metabolism
ccx00630  Glyoxylate and dicarboxylate metabolism
ccx01100  Metabolic pathways
ccx01110  Biosynthesis of secondary metabolites
ccx01120  Microbial metabolism in diverse environments
ccx01200  Carbon metabolism
Module
ccx_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ccx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    COCOR_07034 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    COCOR_07034 (aceB)
Enzymes [BR:ccx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     COCOR_07034 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFE07952
UniProt: H8MFV4
Position
8843406..8845028
Genome map
AA seq 540 aa AA seqDB search
MDARTSQNPPAFGPGVTVEGAWHPDYAEVLTQEAMAFVAKLVRTFGERREALLERRKKVA
QGWRKGERPHFLPETADIRKGDWTVSPVPADLQDRRVEITGPVDRKMIINALNSGASVFM
ADFEDANSPTWDNVVRGQLNLRDAVRKTISFTAENGKHYALNDKHAVLFVRPRGWHLPER
HVRIDGKPISGSLFDFGLFFFHNAREQLKRGTGPYFYLPKMQSHLEARLWNDVFHLAQSE
LDIPRGTIKATVLIETLPAAFEMDEILYELREHSAGLNCGRWDYIFSFIKTLQSDASVVL
PDRGQVTMDKGFLNAYSQLLIQTCHRRGAHAMGGMAAFIPIKGDTAANDAVMAKVRADKL
REAKNGHDGTWVAHPGLVPVAREIFDAQMQGANQVANKREDVRITESDLLQLPSGTRTEE
GLRHNIRVGIQYTAAWLGGLGCVPLYNLMEDAATAEISRAQVWQWIHHEATLEDGRKVTP
ELFRKLLAEEMAQMGREGAVERYGQAHMEKSRALFEQLSTAPAFEDFLTLPAYEALDPQS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgcgcacctcccagaatcccccggccttcggccccggcgtgaccgtggagggc
gcctggcacccggactacgcggaggtgctgacgcaggaggccatggccttcgtggcgaag
ctggtccgcactttcggtgaacggcgggaagcactgctggagcggcgcaagaaggtggcg
cagggctggcgcaagggtgagcgcccccacttcctcccggagacggcggacatcaggaag
ggcgactggaccgtgtccccggtgcccgcggacctgcaggaccggcgcgtggagatcacc
ggtccggtggaccgcaagatgatcatcaacgcgctcaactccggcgccagcgtgttcatg
gcggacttcgaggacgccaacagccccacctgggacaacgtggtgcgcggccagctgaac
ctgcgcgacgccgtgcggaagaccatctccttcaccgcggagaacgggaagcactacgca
ctcaacgacaagcacgcggtcctcttcgtgcgcccgcgcggctggcacctgccggagcgc
cacgtgcgcatcgacggcaagcccatctccggctcgctcttcgacttcggcctgttcttc
ttccacaacgcgcgcgagcagctcaagcgcggcacgggtccctacttctacctgcccaag
atgcagagccacctggaggcccggctgtggaacgacgtgttccacctggcccagagcgag
ctggacatcccgcgcggcaccatcaaggccacggtcctcatcgagacgctgcccgccgcg
ttcgagatggacgaaatcctctacgagctgcgcgagcactcggccggcctcaactgcggc
cgctgggactacatcttcagcttcatcaagacgctccagtccgacgcgtccgtggtgctg
cccgaccgcgggcaggtgaccatggacaagggcttcctcaacgcctactcgcagctgctc
atccagacctgccaccgccggggcgcgcacgccatgggcggcatggccgccttcatcccc
atcaagggggacacggccgccaacgacgcggtgatggccaaggtccgcgcggacaagctg
cgcgaggcgaagaacggccacgacggcacctgggtggcgcaccccggcctggtccccgtg
gccagggagatcttcgacgcgcagatgcagggcgccaaccaggtggccaacaagcgcgag
gacgtgcgcatcacggagagcgacctgctccagctgccctccggcacgcgcacggaggag
ggcctgcgccacaacatccgcgtgggcatccagtacaccgccgcgtggctgggcggcctg
ggctgcgtgccgctctacaacctgatggaggacgcggccacggcggaaatctcccgcgcc
caggtgtggcagtggatccaccacgaggccacgctggaggacggccgcaaggtgacgccg
gagctgttccgcaagctgctcgcggaggagatggcgcagatgggccgcgagggcgctgtc
gagcgctacggccaggcgcacatggagaagtcccgcgccctcttcgagcagctgtccacc
gcgcccgccttcgaggacttcctcacgctgcctgcgtacgaggccctcgaccctcagtcc
tga

DBGET integrated database retrieval system