KEGG   Campylobacter coli RM4661: YSS_03260Help
Entry
YSS_03260         CDS       T03166                                 

Definition
(GenBank) glycyl-tRNA synthetase
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
ccy  Campylobacter coli RM4661
Pathway
ccy00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ccy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YSS_03260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ccy01007]
    YSS_03260
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ccy03016]
    YSS_03260
Enzymes [BR:ccy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     YSS_03260
Amino acid related enzymes [BR:ccy01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   YSS_03260
Transfer RNA biogenesis [BR:ccy03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    YSS_03260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e Lipase_C
Motif
Other DBs
NCBI-ProteinID: AHK76582
UniProt: W8KI01
Position
634226..635089
Genome map
AA seq 287 aa AA seqDB search
MTFSQMILNLQEFWQKQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWATAYVAPSRRPT
DGRYGENPNRLGAYYQFQVLMKPSPDNIQELYLKSLENLGFDLKSHDVRFVEDNWESPSL
GAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWS
EFNGEKIKYADVHKRSEYEFSKYNFEISNVDFLNQQFENTYKECKSILEQGLALPAYDYC
MLAAHTFNLLDARGAISVAQRQDYMLKIRELSKTCAEIYKKNLDETD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgactttttctcagatgatattaaatttacaagagttttggcaaaaacaaggttgtgca
atcatgcagccttacgatatgccagcaggagctggaactttccatccagcaactttttta
agaagtctaggcaaaaaaccttgggctactgcttatgtagctccttcgcgtcgtccaaca
gatggaagatatggagaaaatcctaatcgtctaggagcctattatcaatttcaagtccta
atgaagccaagtcctgataatattcaagaactttatttaaaaagccttgaaaatttaggt
tttgatcttaaaagccatgatgtgcgttttgttgaagacaattgggagagtccaagtctt
ggcgcttggggtcttggttgggaagtttggcttgatggtatggaagtaactcaatttacc
tattttcaacaagttggtggaattgcagtagatttggtaagtgctgaaatcacttatgga
cttgagagaattgctatgtatctccaaaatgtagataatgtttatgatattgtttggagc
gaatttaatggggaaaaaattaaatacgcagatgtgcataagcgcagcgagtatgaattt
agtaaatataattttgaaatcagcaatgtagattttttaaatcagcaatttgaaaatact
tataaagaatgtaaaagtattttagaacagggattggctttgcctgcttatgattattgt
atgcttgcagctcatacttttaacttacttgatgcaagaggtgctatttctgttgcacaa
agacaagattatatgctaaaaattcgcgagctttcgaaaacttgtgctgaaatttataag
aaaaatttagatgaaactgattga

DBGET integrated database retrieval system