KEGG   Capnocytophaga cynodegmi: CGC48_04935Help
Entry
CGC48_04935       CDS       T05499                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
ccyn  Capnocytophaga cynodegmi
Pathway
ccyn00900  Terpenoid backbone biosynthesis
ccyn01110  Biosynthesis of secondary metabolites
ccyn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ccyn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CGC48_04935
Enzymes [BR:ccyn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     CGC48_04935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ATA68035
UniProt: A0A250E8G3
Position
complement(1095299..1096606)
Genome map
AA seq 435 aa AA seqDB search
MKKIEGFSKLTKQQKIDWLCETYFSGDEQAYSYFQKYQNADENLQKLHDEFIENAISNYY
LPFAIAPNFVINGKTYTIPMVIEESSVVAAASRAAKFWESRGGFKAEVISTEKNGQVHFM
FYGEKADLESFFAKVKPKMLSDAQVITANMQKRGGGITDIRLVDKTSELANYYQLFVTFE
TLDAMGANFINSCLESFSQTFRTEAVNFPEIDKKYEIVMSILSNYVPECLVRVAVSCPTE
RLAIANLGGREFAEKFVRAIAIANAEVRRATTHNKGIMNGIDSVILATGNDFRAVEAGIH
AYASRSGKYQSLTKAYVKDDIFHFEIEVPLALGTVGGLTNLHPLVKTALQILEKPSAKEL
MQIAATVGLAQNFAAVSSLITLGIQKGHMKMHLMNILNQLGANEAQKKYITNYFKDKILT
HREVSDVFESIRHLN
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagaaggattttcaaaattaacgaaacaacagaagattgattggctatgt
gaaacctatttttctggtgatgaacaggcatattcgtactttcaaaaatatcagaatgca
gatgaaaatctacagaaattgcacgatgaattcatagaaaacgcgatttctaattactat
ttgccctttgcaatagcacctaatttcgttataaatggaaagacctacactatcccgatg
gttattgaggaaagttccgtggtggctgctgccagtcgggctgctaaattttgggaatct
cgcgggggatttaaagcagaggtaatttctactgaaaaaaacggacaagtacattttatg
ttttatggagagaaagcagatttagaaagctttttcgcgaaagttaagcctaaaatgttg
tctgatgcacaagttattacagccaatatgcaaaagcgaggtggaggcataacggacata
cgtttggtggataaaacctctgaacttgctaattactatcagctttttgttacttttgag
acgttagatgcaatgggagcgaattttatcaattcgtgtttggaatctttttcacagact
tttcgtacagaagctgtaaatttccccgaaattgataaaaaatatgagattgtaatgtca
attttgtcaaattatgttccagaatgcttggttcgggttgcagtttcttgtccaacagaa
cgtttggctattgcaaatttgggaggaagggaattcgcagaaaaatttgtcagagctatt
gcaattgcaaatgctgaggtgcgtcgggcaacgacccataataaaggcattatgaatggc
atagattctgtaattttagccacaggaaatgattttcgtgcagtggaagcaggtattcac
gcctatgcttcgcgaagtggaaaatatcaaagtttgactaaggcttatgttaaagacgat
atttttcattttgaaatagaggtgcctttggctctcggaactgttggtggtctgacgaac
ttgcatccacttgtaaaaacagctttacaaattttggaaaaaccttcggctaaggaattg
atgcaaattgctgctacggtgggattggctcagaattttgctgcagtaagttcactaatt
acacttggaattcaaaaagggcatatgaagatgcatctgatgaatattttgaaccagtta
ggagctaatgaagctcaaaaaaaatacattactaactattttaaagataaaatattaaca
cacagggaagtgtcagacgtttttgaaagtattcgtcacttaaattga

DBGET integrated database retrieval system