KEGG   Capnocytophaga cynodegmi: CGC48_10310Help
Entry
CGC48_10310       CDS       T05499                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ccyn  Capnocytophaga cynodegmi
Pathway
ccyn00471  D-Glutamine and D-glutamate metabolism
ccyn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccyn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CGC48_10310 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccyn01011]
    CGC48_10310 (murI)
Enzymes [BR:ccyn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CGC48_10310 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:ccyn01011]
 Precursor biosynthesis
  Racemase
   CGC48_10310 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ATA68975
UniProt: A0A250EB48
Position
2332497..2333291
Genome map
AA seq 264 aa AA seqDB search
MINKEKPIGLFDSGVGGTTIWKEIVKLLPYENTLFLADNKNAPYGGKTKEEIIFLCEKNT
EFLLENEVKIIVVACNTGTTNAISHLRTKYKEIPFIGIEPAIKPAGLQSVTKKVGVLATK
GTLSSELFMKTSNNLIKNEGIQIVERVGEGLVSLIESGKIESPEMFELLKEYLLPMVEEN
IDYLVLGCTHYPYLLPQIQKIIPENIKVIDSGYAVAKQTKNVLSQNNLLNDFQNKPHHIW
LSNGDLSILQQFAPDIDNLKLQKI
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaagaaaaaccaataggattgtttgattcaggggtaggaggaaccacgatt
tggaaagaaatagtaaaactactaccttacgaaaatacactatttctggcagataataaa
aatgctccttacggaggaaaaacgaaagaagaaataatctttctgtgtgaaaaaaataca
gaatttctgttagaaaatgaagttaaaattattgtagttgcttgtaatacaggaacaacg
aatgcaatatcgcatttacgtaccaaatataaagaaattccttttataggaatagaacca
gctattaaaccagcaggtttacagagtgttactaaaaaagttggcgttttagcaactaaa
gggacactttcaagtgaactatttatgaaaacaagtaataatctgattaaaaatgaagga
attcagattgttgaaagagtaggagagggattagtaagcctgattgaaagcggaaaaatt
gaaagccctgaaatgtttgaattgctaaaagaatacctattgcctatggtagaagaaaat
atagactacttggtacttggttgtacacattatccttatttattgcctcaaattcaaaaa
attattcctgaaaatataaaggtaatagattcggggtacgctgttgcaaaacagacaaaa
aatgtactctcacaaaacaatttgctaaatgatttccaaaacaaaccccatcacatttgg
ttaagtaatggggatttatctattttacagcaatttgcaccagatatagacaacttaaaa
cttcaaaagatttaa

DBGET integrated database retrieval system