KEGG   Chthonomonas calidirosea: CCALI_01261Help
Entry
CCALI_01261       CDS       T02699                                 

Definition
(GenBank) Phenylalanine 4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
ccz  Chthonomonas calidirosea
Pathway
ccz00360  Phenylalanine metabolism
ccz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ccz00790  Folate biosynthesis
ccz01100  Metabolic pathways
ccz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ccz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CCALI_01261
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CCALI_01261
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CCALI_01261
Enzymes [BR:ccz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     CCALI_01261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: CCW35079
UniProt: S0EUN8
Position
complement(1488641..1489558)
Genome map
AA seq 305 aa AA seqDB search
MNIGLTTTKAPFIEEARGAGQLFITQPYALYSEENHEAWRQLYGRMLPLWQRYANPHFLK
GLQCLCLPPDRVPKLEEVNRFLEPLTGFRAKAVSGYVPAFLFFDCLRNREFPTTITVRSL
ENLDYLPEPDIFHDIAGHVPMHTDPAFAETLVRLGDCAHTAVEMVAGISDPKEQLRRLTS
ILKAFARFFWFTIEFGLMNTPEGLKVYGSGLLSSYGEIVHSIESPEVQRYPLQIEWVINQ
AFEIDHYQPLLFVVESFDQLYQLVDTLERWMREGRLNNVAPGEPTMHERDLQSFLHVVSE
EVHDA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcggattaacgacgacaaaggccccctttattgaggaggcacgaggcgcaggc
cagctcttcatcacacagccttatgccctctatagtgaggagaaccacgaggcttggcga
cagctctatgggcgtatgctgcccctgtggcagcgctacgcgaacccgcattttctgaaa
gggctacaatgtctttgtttgcctcccgatcgggtaccaaaactagaggaggtgaaccgc
ttcctcgaaccacttaccgggtttcgtgcgaaagcggtaagcggttacgtgccggccttc
cttttcttcgattgtctgcggaatcgagagttcccgacaacgatcacggtgaggtcgcta
gaaaaccttgattacctgcccgaacccgatatcttccacgacattgccggccacgtgccg
atgcacaccgacccggctttcgccgagacactcgttcgcctcggcgattgtgcccacacc
gccgtggagatggtggccggaataagcgacccgaaggagcaactgcgccggctgaccagc
attctgaaagcgttcgctcgattcttttggtttaccattgagttcggactcatgaataca
cccgaagggctgaaagtctacggaagtggtcttttaagctcctatggggagatcgtgcac
agcatcgagtcgccagaggtacagcgctatcctttgcagatcgagtgggtcatcaatcaa
gcattcgagatagaccactatcagccactgctgtttgtggtggagagcttcgatcagctc
tatcagctggtggacacactagagagatggatgcgtgaagggcggcttaacaatgttgct
cctggcgaacctacgatgcatgaaagggacctgcagagtttccttcatgttgtcagtgag
gaagtccatgatgcgtga

DBGET integrated database retrieval system