KEGG   Chthonomonas calidirosea: CCALI_01480Help
Entry
CCALI_01480       CDS       T02699                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ccz  Chthonomonas calidirosea
Pathway
ccz00471  D-Glutamine and D-glutamate metabolism
ccz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CCALI_01480
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccz01011]
    CCALI_01480
Enzymes [BR:ccz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CCALI_01480
Peptidoglycan biosynthesis and degradation proteins [BR:ccz01011]
 Precursor biosynthesis
  Racemase
   CCALI_01480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: CCW35296
UniProt: S0EYY0
Position
complement(1739912..1740742)
Genome map
AA seq 276 aa AA seqDB search
MSVPFLGVFDSGVGGLTVVHALRKVAPRMPIWYVADQAHVPYGGRPLEEVRAFACGISEA
LLAKRDGVSECVGVVMACNISSAVALPVVQAKYPHVPVLGMVEPGVRAAVKRTRNGRIGV
LATEGTVQSGAYRQTLGRVAPDVEVYEVACPAFVPLVEAGAEGSEAAREAACRYLHELES
RDVDTVILGCTHYPFLLPLLRRLSPQFVYVDPAEPTAEMVGEKLSSLKTPDVPRHQLFTT
GDVGVFHAQLERLFPDLLLVSEVKPAWWDDGQLLLG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgttccgttcctcggcgtgttcgattcgggtgttggagggttgacggtggtacat
gcccttcgcaaggtggccccgcgtatgccgatctggtatgttgcggatcaggcgcatgtg
ccttatggtgggcgtcccttagaggaggtgcgcgcgtttgcctgcggcatcagcgaggcg
ctgttagccaaaagagatggcgttagcgagtgtgtgggtgtggtgatggcgtgcaacatc
tcttcggccgtcgctttgccggtcgttcaggcaaaataccctcatgtgcccgttttgggg
atggttgagccgggggtgcgagcggccgtaaagcgtacgcggaacggccgtattggggtg
cttgccacagaagggacggttcagagcggtgcctaccgccagacgctaggccgagtcgcg
cccgatgtggaggtgtacgaggtcgcttgtcccgcctttgttccccttgtggaggccggt
gcggaggggagcgaggcggcacgggaggccgcttgtcgctacttgcatgaattggaatct
cgcgatgtagatacggtgatattgggttgtacgcactatccttttctgcttcctctctta
aggcgcctcagcccgcagtttgtgtatgtagatccggccgaacccaccgcggagatggtt
ggcgaaaagttgtcttctcttaagacgcctgacgtgccgcgccatcagcttttcaccacg
ggcgacgtgggagtgtttcatgcgcaactggagcgtctcttccccgatctgctgttggtt
tccgaagtgaaaccggcctggtgggatgacgggcaacttctattgggttaa

DBGET integrated database retrieval system