KEGG   Corynebacterium diphtheriae BH8: CDBH8_0328Help
Entry
CDBH8_0328        CDS       T01698                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00010  Glycolysis / Gluconeogenesis
cdb00260  Glycine, serine and threonine metabolism
cdb00680  Methane metabolism
cdb01100  Metabolic pathways
cdb01110  Biosynthesis of secondary metabolites
cdb01120  Microbial metabolism in diverse environments
cdb01130  Biosynthesis of antibiotics
cdb01200  Carbon metabolism
cdb01230  Biosynthesis of amino acids
Module
cdb_M00002  Glycolysis, core module involving three-carbon compounds
cdb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDBH8_0328 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CDBH8_0328 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDBH8_0328 (gpmA)
Enzymes [BR:cdb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CDBH8_0328 (gpmA)
Membrane trafficking [BR:cdb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CDBH8_0328 (gpmA)
Exosome [BR:cdb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CDBH8_0328 (gpmA)
  Exosomal proteins of melanoma cells
   CDBH8_0328 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEX47853
Position
326806..327552
Genome map
AA seq 248 aa AA seqDB search
MTTGKLILLRHGQSEWNASNQFTGWVDVNLTEKGEAEAKRGGELLKAQGVLPSVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKEKYGDEQFMTWRRSYG
TPPPELEDSSEFSQANDPRYANLDVVPRTECLKDVVERFVPYFKEEILPRVQNGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDEAGTVLNPGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactactggaaaactgattcttcttcgtcacggacaaagcgaatggaacgcttccaac
cagttcaccggctgggtggacgtcaacctcaccgaaaagggcgaggcagaggctaagcgc
ggcggcgaactgctcaaggctcagggggtcctgccaagcgtggtgtacacctctttgctg
cgccgtgctatccgcaccgccaacattgctctgaacgctgctgatcgccactggatccca
gttgttcgcgattggcgcctcaacgagcgccactacggtgcgctgcagggcctgaataag
gctgagactaaggaaaagtacggcgacgagcagttcatgacatggcgtcgttcttatggc
accccaccaccagagcttgaggattccagcgagttctcccaggcaaacgatcctcgttac
gccaaccttgacgtggttcctcgcaccgagtgcttgaaggacgttgttgagcgtttcgtt
ccttacttcaaggaagagatcctgccacgtgtacagaacggtgagactgttttgatcgct
gcacacggtaactccctgcgtgcattggtcaagcacctagacaacatctctgatgcagac
atcgctgagctcaacattcctaccggtattccactggtttatgagcttgacgaggctggc
acggtgctcaacccaggtggcacctaccttgacccagaggctgctgctgccggtgctgcc
gcagttgctgctcagggcgctaagtag

DBGET integrated database retrieval system