KEGG   Corynebacterium diphtheriae BH8: CDBH8_1067Help
Entry
CDBH8_1067        CDS       T01698                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00010  Glycolysis / Gluconeogenesis
cdb00030  Pentose phosphate pathway
cdb00051  Fructose and mannose metabolism
cdb00052  Galactose metabolism
cdb00680  Methane metabolism
cdb01100  Metabolic pathways
cdb01110  Biosynthesis of secondary metabolites
cdb01120  Microbial metabolism in diverse environments
cdb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDBH8_1067 (pfkA)
   00030 Pentose phosphate pathway
    CDBH8_1067 (pfkA)
   00051 Fructose and mannose metabolism
    CDBH8_1067 (pfkA)
   00052 Galactose metabolism
    CDBH8_1067 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CDBH8_1067 (pfkA)
Enzymes [BR:cdb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CDBH8_1067 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CDBH8_1067 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEX48590
Position
1072416..1073444
Genome map
AA seq 342 aa AA seqDB search
MRIATLTSGGDCPGLNAVIRGIVRTCSEYGSTVVGYQDGWVGLMEDKRIQLYDDENIDRI
LLRGGTILGTGRLHPDKFKSGLDQIKANLEDAGIDALIPIGGEGTLKGAKWLSDNGIPVV
GVPKTIDNDVNGTDYTFGFDTAVSVATDAIDRLHTTAESHNRVMIVEVMGRHVGWIALHA
GMAGGAHYTVIPEQPFDIAEICKAMERRFQMGEKYGIIVVAEGALPKEDTMDFAEGGVDQ
FGHQTFNGIGQVIGEEIKKRLGHDVRTTVLGHIQRGGTPTSYDRVLATRYGVHAARACHN
GDYGKMVALHGEHIDLIPLEDAVDTLKTVPEGRYRTARALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcgactcttacatccggcggcgattgccccggcctcaacgctgtgatccgc
ggcattgtccgcacatgttctgagtacggctcgaccgtcgttggataccaagacggctgg
gtggggctcatggaagacaagcgcattcaactatatgacgatgaaaacatcgatcgtatc
ctgttgcgcggcggaaccattttgggtaccggccgccttcaccctgacaagtttaagtct
ggtcttgaccagattaaggcaaaccttgaggatgcaggtattgatgcactgattcctatc
ggtggcgaaggtacacttaagggtgccaagtggctatctgataatggtattcctgtagtt
ggcgtgcctaagacgatcgacaacgacgttaacggtacggattacacttttggctttgat
accgcagtctctgttgctacggatgctatcgaccgactgcacactacagctgagtctcac
aaccgtgtgatgatcgttgaggttatgggtcgtcacgttggctggattgcgctgcacgcc
ggcatggcaggcggtgcgcattacacagtcattcctgagcagccatttgatattgcagag
atctgcaaggcaatggaacgtcgcttccagatgggtgaaaagtacggcattatcgtcgtg
gcggaaggtgcactgcctaaggaagacacgatggactttgccgagggcggcgtcgaccaa
tttggccaccaaacgtttaatggcattggtcaagtaattggtgaggaaatcaagaagcgc
ctcggccatgacgttcgtaccacggttttggggcatatccagcgtggtggcacacctact
tcttatgaccgcgttttggctacccgttacggtgttcatgccgcacgtgcgtgccacaac
ggtgattacggcaagatggttgcgttgcacggtgaacatatcgatctgattccgctcgag
gacgcggtagatacgctaaagactgtccctgaaggacgttaccgcacagcacgcgccctg
tttggttaa

DBGET integrated database retrieval system