KEGG   Corynebacterium diphtheriae BH8: CDBH8_1231Help
Entry
CDBH8_1231        CDS       T01698                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00670  One carbon pool by folate
cdb01100  Metabolic pathways
cdb01120  Microbial metabolism in diverse environments
cdb01200  Carbon metabolism
Module
cdb_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cdb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CDBH8_1231 (fhs)
Enzymes [BR:cdb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CDBH8_1231 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS NVEALA
Motif
Other DBs
NCBI-ProteinID: AEX48754
Position
complement(1258393..1260045)
Genome map
AA seq 550 aa AA seqDB search
MPTDVEIAQAHTLEPITDIANRAGVPSDALIPYGFTKAKIDINRIASEKTGKLVLVTGIS
PTPAGEGKSTVLIGLSDAMRLRGHNSIVAIREPSLGPVMGIKGGAAGGGYSQIVPMEDIN
LHFTGDFHAITAANNTLAAMIDNHIHQGNTLGIDVRRITWQRCLDVNDRSLRKVVTGLGG
KAHGVPTETGFTITAASEIMAILCLALDLTDLEARLARIVVGQTFSSEPVTVGQLNAQGA
LAALLRDAVNPNLVQTLGGTPALCHGGPFANIAHGCNSLIATKTALSLGDVVLTEAGFGS
DLGAEKFFDIKSRVGDLNVAATVVVATVRSLKYNAGVPKDELTTENLEALASGVVNLERH
VENIRAFGIEPIVALNKFASDTDAEINQLKAWAETMSVQLIPVEVWAHGGQGALELADAV
AVSMQKQTSHQLYDPELGIEASLLTIAQKIYGAADVELSKQARQDLAYLQENGWDRLPVC
ISKTQYSFSDDPSQLGRPEGHTLHVRNLLPRIGAGFIVALTGDVMTMPGLPKKPAAENIG
VENGEIKGLF
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgacggacgttgaaattgcccaagctcataccctcgagcccatcactgacattgcc
aatcgagctggagtaccttccgatgctctgatcccttatggctttacaaaagcgaaaata
gatattaatcggattgcgagcgaaaaaactggaaaactcgtgctcgtgacagggatttca
ccaacgcctgccggcgaaggtaaatcgactgtcctcattggtctttcggacgcaatgaga
ctacgcggccataattccattgttgctattcgtgaaccttctctaggccccgtaatggga
attaaaggtggagccgcaggtggtggatattcacagatcgttcctatggaagacatcaat
ctgcatttcactggagactttcatgcaatcacggcagctaacaacacgctggcagcaatg
attgacaatcatattcatcaaggcaatactctaggaattgatgtccgtcggattacttgg
caacgttgcctggatgtaaacgaccgctctttgcgcaaagttgtgactggcctaggtggt
aaagcacatggagtgccaactgaaacaggattcacgattacagccgcgagtgaaatcatg
gcgattctatgtctggcattagatctaacagatttggaagcacgcttggcacggattgtt
gtaggccagacatttagcagtgaaccagttaccgttggtcaacttaatgcgcaaggagca
cttgcagcgttgcttcgtgatgcagttaatccaaatttagttcaaacattgggtggaaca
cctgcgttgtgccatggtgggccattcgcgaatattgcccatgggtgtaactctcttatc
gctacaaaaacggcgctgtcactcggagatgtcgtactgacggaagcaggattcgggtcc
gacctcggtgccgaaaaattcttcgacattaagtcgcgcgtaggcgacctcaatgttgct
gcaaccgtcgttgtcgcaactgtaaggtctcttaaatacaacgccggcgttcctaaagat
gagctcacaaccgaaaacctggaagctcttgcatctggagtcgtcaatctcgaacggcac
gttgaaaatattcgtgcgtttggtatcgaaccaattgttgcactgaataaatttgcctcg
gacactgatgcagaaatcaatcagctcaaagcttgggctgaaaccatgtcggttcaattg
atcccagtcgaagtttgggctcatggtgggcaaggcgcgctagaacttgccgacgcagtt
gcagtctcgatgcaaaaacaaacttcgcatcaactttatgaccccgaactgggaattgaa
gcatcactgctcacaattgcgcaaaaaatctacggcgcggcagatgttgagttgtcgaag
caagcgcgtcaagatctggcatatttgcaagaaaatggatgggatcgcttgccagtatgt
atttccaagacacaatattcattcagtgatgatccatctcagctagggcgtccagaagga
catactcttcacgttcgcaatttattgccacgaatcggtgcaggatttatcgttgctctt
accggtgatgtcatgaccatgcctggccttccgaaaaaaccagccgctgaaaacatcgga
gttgaaaatggagagattaaaggccttttctaa

DBGET integrated database retrieval system