KEGG   Corynebacterium diphtheriae BH8: CDBH8_2016Help
Entry
CDBH8_2016        CDS       T01698                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
cdb  Corynebacterium diphtheriae BH8
Pathway
cdb00430  Taurine and hypotaurine metabolism
cdb00620  Pyruvate metabolism
cdb00640  Propanoate metabolism
cdb00680  Methane metabolism
cdb01100  Metabolic pathways
cdb01120  Microbial metabolism in diverse environments
cdb01200  Carbon metabolism
Module
cdb_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:cdb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDBH8_2016 (ackA)
   00640 Propanoate metabolism
    CDBH8_2016 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    CDBH8_2016 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CDBH8_2016 (ackA)
Enzymes [BR:cdb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CDBH8_2016 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AEX49533
Position
complement(2098344..2099543)
Genome map
AA seq 399 aa AA seqDB search
MALVLVLNSGSSSIKFQLVDPTAHATDDPFASGLVEQIGEPQGRVTLKHAGEKFVVEAPI
PDHSAGLALAFDLMGEHKCGPTDVEIIAVGHRVVHGGILFSQPQVITDEIMDMVRDLIPL
APLHNPANIDGIEVARKILPDVAHVAVFDTGFFHDMPPAAAIYAIDAKTAADHGVRRYGF
HGTSHEYVSHKVAELLDLPEGAINQITLHLGNGASCAAIRGGKAIDTSMGMTPLSGLVMG
TRSGDIDPGIVFHLHRQAGMSIDEIDELLNKKSGVKGISGVNDFRELRTMIDAGDQDAWL
AYNIYIHQLRRYIGSYMIALGRVNAITFTAGVGENDVAVRADALSHLEGFGIKIDPERNA
LPNTGPREISTDDSAIKVFVVPTNEELAIARYAKALSGA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgtcctcgtcctcaattctggttcttcatctatcaagttccagctggtagac
cctaccgcccacgccactgacgacccgtttgcctctggtttggtggaacagattggtgag
ccacagggtcgagtgactctgaagcacgctggtgagaagttcgtcgtcgaggcaccgatt
cctgatcactccgctggtttggcgttggctttcgatctgatgggtgagcacaagtgtggt
cctactgatgtggagatcattgctgtgggtcaccgcgtggttcacggtggtattttgttc
tcccagccgcaggtaattacggatgagatcatggacatggtccgcgatctgattccgctg
gctcccctgcacaaccctgccaacattgatggcattgaggttgctcgcaagatcttgcct
gatgtggcacacgttgcggtctttgatactggtttcttccacgatatgccaccagcggca
gcgatttacgctatcgacgccaagactgccgcggatcatggtgtgcgtcgctatggcttc
cacggcaccagccacgagtatgtgtctcataaggtggctgagctgctggatcttccggaa
ggcgctatcaaccagatcaccttgcacctaggtaatggtgcttcgtgcgctgctatccgt
ggtggcaaggctattgacacctcgatgggcatgacccccttgtctggtcttgtgatgggt
acgcgttcgggtgatattgacccaggtattgtgttccacttgcaccgtcaggcgggtatg
agcattgatgagatcgatgagctgctgaacaagaagtccggtgtgaagggcatctcgggg
gttaatgacttccgtgagctgcgcaccatgattgacgccggcgaccaggacgcttggctg
gcgtacaacatttacattcaccagctgcgtcgctacatcggttcctacatgatcgccctt
ggtcgcgtaaacgctattacgttcaccgcaggtgttggcgagaacgacgtggccgtgcgt
gccgacgccctctcgcacctcgaaggctttggcatcaagatcgacccagagcgcaacgca
ttgccaaacactggcccacgtgaaatctcgacggacgattccgccatcaaggttttcgtg
gttcctaccaacgaggagctcgctatcgcacgctacgccaaggcactctccggcgcataa

DBGET integrated database retrieval system