KEGG   Clostridioides difficile CD196: CD196_0402
Entry
CD196_0402        CDS       T00997                                 

Gene name
oraS
Definition
(GenBank) D-ornithine aminomutase S component
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00472  D-Arginine and D-ornithine metabolism
cdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CD196_0402 (oraS)
Enzymes [BR:cdc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CD196_0402 (oraS)
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: CBA60788
UniProt: A0A0H3MZX7
Position
468101..468475
AA seq 124 aa
MKKREDDFEVRRKHLQELSDDELKERFWNLATQIVEPMIELGKKNTTPSIERSVLLRMGF
SSLEVKPILEGVMERGLIGKGAGHVVYKLAKSKNITVREAGLLLVKGEYWDEVTCLFREG
VESC
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaaaaaaagagaggatgattttgaagttagaagaaaacatcttcaagaactgagtgat
gatgagttaaaagaaaggttttggaatttagctacccagatagtagaaccaatgatagaa
cttggtaaaaagaatacaacaccatcaatagaaaggtctgtcttgttgagaatgggattt
tcttctcttgaagtaaaacctattttagaaggggttatggaaagaggtcttataggtaaa
ggagcagggcatgtagtttataaattggctaaatctaaaaatataacggttagagaagca
ggtttgttattagttaagggtgaatattgggatgaagttacatgtttatttagagaaggg
gtagaatcatgttaa

DBGET integrated database retrieval system