KEGG   Clostridioides difficile CD196: CD196_0663Help
Entry
CD196_0663        CDS       T00997                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00670  One carbon pool by folate
cdc01100  Metabolic pathways
cdc01120  Microbial metabolism in diverse environments
cdc01200  Carbon metabolism
Module
cdc_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cdc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CD196_0663 (fhs)
Enzymes [BR:cdc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CD196_0663 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA AAA_31
Motif
Other DBs
NCBI-ProteinID: CBA61270
UniProt: A0A0H3N4G2
Position
805593..807269
Genome map
AA seq 558 aa AA seqDB search
MGFKSDIEIAQEAKPQDIREVAKKLGLGEDDVELYGKYKAKVDYNLLKRETGKKAKLILT
TAINPTPAGEGKTTTTIGVADAFAKLDKNVLVALREPSLGPVFGVKGGAAGGGYAQVVPM
EDINLHFTGDFHAIGAANNLLAAMLDNHIHQGNALRIDPKKITWRRCVDMNDRQLRNIVD
GMGKKGDGAVRQDGFDITVASEIMAAFCLASDISDLKERLGNIIVGYSYEGEPVTARQLK
ANGAMAALLKDALKPNLVQTLEGTPSFVHGGPFANIAHGCNSVIATRMAMHFADYVITEA
GFGADLGAEKFLDIKCRMANLKPDAVIIVATVRALKYNGGVAKADLNNENLEALEKGLPN
LLKHVENITQVYGLPAVVAINRFPLDTEAELKLVEDKCKELGVNVALSEVWAKGGEGGIA
VAKEVLRLLDEEENNFRFCYEDDLSIKDKINAIATKIYGADGVDYTPEADKEIANLEKLG
FTKVPVCMAKTQYSLTDDQTKLGRPTGFRITVRQATISAGAGFIVALTGEIMKMPGLPKV
PAAEKIDVDENGVIAGLF
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgggatttaaatctgacattgaaatagctcaagaagctaagcctcaagatattagagag
gttgcaaaaaaattaggactaggtgaagatgatgtagaactttatggtaaatacaaagca
aaagttgactacaatctactaaaaagagagactggtaaaaaagctaagttaatactaact
acagctataaatccaactccagcaggtgaaggaaaaactactactactataggtgttgct
gatgcatttgctaaactagacaaaaatgtattagttgctttaagagaaccatctctagga
ccagtatttggtgttaaaggtggagcagctggtggaggatatgcacaagttgttcctatg
gaagatataaacttacacttcacaggagattttcacgctataggagctgctaacaatctt
ttagctgctatgcttgataaccatattcaccaaggaaatgcacttagaatagaccctaag
aaaataacttggagaagatgtgtggacatgaacgatagacaacttagaaatatcgttgat
ggtatgggtaaaaaaggtgatggagcagttagacaagatggattcgatataactgttgct
tctgaaataatggcagcgttctgtttggcaagtgatatatctgatttaaaagaaagatta
ggaaacataatagttggatacagctatgaaggtgaacctgtaacagctagacaattaaaa
gctaatggtgctatggctgcattattaaaagatgctttaaaaccaaacctagttcaaact
cttgaaggaacaccatcatttgtacacggtggaccattcgcaaatatagctcatggatgt
aactctgttatagctacaagaatggctatgcactttgcagactatgtaataactgaggct
ggtttcggtgctgaccttggagcagaaaaattcttagatataaaatgtagaatggcaaac
ttaaaaccagatgctgttataatagttgctactgtaagagcattaaaatacaatggtgga
gttgctaaagcagacttaaataacgaaaacctagaagctcttgaaaaaggacttccaaac
ttattaaaacatgttgaaaacataactcaagtatatggattaccagcagttgttgcaatc
aatagattcccacttgatactgaagctgaacttaaacttgttgaagacaagtgtaaggaa
ttaggtgttaatgttgctctttctgaagtatgggcaaaaggtggagaaggtggaattgca
gtagctaaagaagttttaagattattggatgaagaagaaaataactttagattctgctat
gaagatgatttatctataaaagacaagataaatgctatagctactaagatttatggagca
gatggtgtagattatactcctgaagctgataaggaaatagctaacttagaaaaacttgga
tttactaaagttccagtatgtatggctaagactcaatattctttaactgatgaccaaact
aaattaggtagaccaacaggatttagaataactgtaagacaagcaacaatttcagcagga
gctggatttatagttgcacttactggagaaataatgaagatgccaggattaccaaaagtt
ccagcagcagaaaaaatagatgttgatgaaaatggagtaatagctggattattctaa

DBGET integrated database retrieval system