KEGG   Clostridioides difficile CD196: CD196_2341Help
Entry
CD196_2341        CDS       T00997                                 

Gene name
selD
Definition
(GenBank) selenide,water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00450  Selenocompound metabolism
cdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CD196_2341 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cdc03016]
    CD196_2341 (selD)
Enzymes [BR:cdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CD196_2341 (selD)
Transfer RNA biogenesis [BR:cdc03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    CD196_2341 (selD)
 Prokaryotic type
    CD196_2341 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: CBA64487
UniProt: A0A0H3N4D2
Position
complement(2715567..2716517)
Genome map
AA seq 316 aa AA seqDB search
MPKNDNIENLLVGLDTADDAAVYKLNDDMALIQTLDFFTPMVDNPYVFGQIAASNSLSDV
YAMGGKPLVAMNIVCFPSCHDMDVLAEILKGGFDKVKESGALLVGGHTVDDKEPKYGLSV
SGIVSPNKVLSNATAKPGDKLIITKPIGVGVLNTAMKEGMVEQHIADKVIEIMIHLNKYA
AMSFEKFDVNSVTDITGFGLLGHTLEMAKASEVSIEIESKHVPIIEGAIEMAQMGIIPAG
MYKNMHYVSKDVEVVGNIEVAVQDILYDPQTSGGLLISVKEELAEELVKDMKLNGAIEAK
IIGSVVPKGEKYITVL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgcctaaaaatgataatatagaaaatttattagtaggactagatacagcagatgatgct
gcagtttataaattaaatgatgatatggcacttatccaaactttagacttctttacacca
atggtagataacccatacgtatttggtcaaattgctgcatcaaattcactatcagatgta
tatgctatgggaggcaaacctttggttgctatgaatattgtttgttttccatcatgccat
gatatggatgtacttgcggaaatattaaaaggtgggtttgataaagtgaaagaaagtgga
gcacttttggttggagggcatactgtagatgacaaagagcctaaatatggtctttcagtt
tctgggattgtaagtccaaataaagttttatcaaatgctactgcaaaacctggtgataag
ttaattataacaaaaccaattggagtgggtgtattaaatacagccatgaaagaaggtatg
gtagaacaacatatagcagataaagtaatagaaataatgatacatttaaataaatatgca
gcaatgagttttgagaaatttgatgtaaattcggttacagatataactggttttggtcta
cttggtcatactttagaaatggccaaagcttctgaagtaagtattgaaattgaatcaaaa
catgtaccaattattgaaggtgcaatagaaatggcacaaatgggaattatacctgctggt
atgtataaaaatatgcattatgtatctaaagatgtagaagttgtaggaaatatagaagtt
gcagttcaagatattttatacgacccacaaacatcaggagggttgttaatttcagtaaaa
gaagaacttgcagaggaacttgtaaaagatatgaaattaaatggagcaatagaagctaaa
attataggttctgtagttccaaaaggggaaaaatatattacagttttataa

DBGET integrated database retrieval system