KEGG   Clostridioides difficile CD196: CD196_2428Help
Entry
CD196_2428        CDS       T00997                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00230  Purine metabolism
cdc01100  Metabolic pathways
Module
cdc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CD196_2428 (gmk)
Enzymes [BR:cdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CD196_2428 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ADK AAA_22 ABC_tran Rad17 AAA_17 ATP_bind_1 MMR_HSR1 Cytidylate_kin RsgA_GTPase AAA AAA_16 cobW
Motif
Other DBs
NCBI-ProteinID: CBA64654
UniProt: A0A0H3NE28
Position
complement(2820342..2820959)
Genome map
AA seq 205 aa AA seqDB search
MFVKKGLLLVVSGPSGAGKGTICKELLKENDTIKLSVSATTRKPRTGEVDGVNYFFISKE
KFEEMIEKGEFLEYAQIYDNFYGTPKAAIMECLEKGQDVLLEIEMQGAKQIKEVCPEGVF
IFVLPPSLEELKNRIVGRGTETEAEIEKRFSCAYEEIKMIKDYDYFIFNEDVKTSAKEIE
GIISSEKNKVSRYKNIIIEKFKEEL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgaaaaaaggattattgctagttgtatcaggaccatcaggtgcaggaaaaggt
actatttgcaaagaactacttaaagaaaatgatacaataaaactttctgtatcagctact
acaagaaaacccagaactggagaagttgatggagtaaattatttcttcataagtaaggaa
aagtttgaagagatgatagaaaaaggtgagtttttggagtatgctcaaatttatgataat
ttttatggaactccaaaagcggcaataatggaatgtttagaaaaaggacaagatgtatta
ctggagattgaaatgcaaggagcaaaacaaataaaagaagtttgcccagagggagtattt
atatttgtactaccaccatcacttgaagaattaaaaaatagaattgttggaagaggtaca
gaaacagaagctgaaatagagaagagatttagctgtgcatatgaagaaattaaaatgatt
aaggattatgattattttatatttaatgaagatgtaaaaacatctgctaaagaaatagaa
ggtataatatcatctgaaaagaataaagttagcagatataaaaatattataatagagaaa
tttaaggaggaattataa

DBGET integrated database retrieval system