KEGG   Clostridioides difficile CD196: CD196_2517Help
Entry
CD196_2517        CDS       T00997                                 

Gene name
thlA2
Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00071  Fatty acid degradation
cdc00072  Synthesis and degradation of ketone bodies
cdc00280  Valine, leucine and isoleucine degradation
cdc00310  Lysine degradation
cdc00362  Benzoate degradation
cdc00380  Tryptophan metabolism
cdc00620  Pyruvate metabolism
cdc00630  Glyoxylate and dicarboxylate metabolism
cdc00640  Propanoate metabolism
cdc00650  Butanoate metabolism
cdc00900  Terpenoid backbone biosynthesis
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01120  Microbial metabolism in diverse environments
cdc01130  Biosynthesis of antibiotics
cdc01200  Carbon metabolism
cdc01212  Fatty acid metabolism
cdc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD196_2517 (thlA2)
   00630 Glyoxylate and dicarboxylate metabolism
    CD196_2517 (thlA2)
   00640 Propanoate metabolism
    CD196_2517 (thlA2)
   00650 Butanoate metabolism
    CD196_2517 (thlA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CD196_2517 (thlA2)
   00072 Synthesis and degradation of ketone bodies
    CD196_2517 (thlA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD196_2517 (thlA2)
   00310 Lysine degradation
    CD196_2517 (thlA2)
   00380 Tryptophan metabolism
    CD196_2517 (thlA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD196_2517 (thlA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD196_2517 (thlA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CD196_2517 (thlA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdc04147]
    CD196_2517 (thlA2)
Enzymes [BR:cdc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CD196_2517 (thlA2)
Exosome [BR:cdc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD196_2517 (thlA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C SpoVAD
Motif
Other DBs
NCBI-ProteinID: CBA64825
UniProt: A0A0H3N9S3
Structure
PDB: 

Position
2925505..2926683
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVSAVRTPIGSFGGVFKNTSAVQLGTIAVKEAISRVGLNLSEIDEVIIGNVLQTG
LGQNVARQIAINSGIPNSVPSYTVNKLCGSGLKSVQLAAQSITSGENDVVIAGGTENMSQ
APYIVPTARFGSKMGDITMVDSMLTDGLIDAFNQYHMGITAENIATKFEFTREMQDKLAL
ESQNKAENAIKNNRFKEEIVPVDVLIRRGKIETIDKDEYPKLGMTFEGLAKLKPAFKKDG
TVTAGNASGINDGAAMLILMSQQKADELGIRPLAKIKSYASAGVEPEVMGTGPIPATRKA
LKKAGLSINDIDLIEANEAFAAQALAVKNELQIDSSKLNVNGGAIALGHPIGASGARILV
TLIYEMQKRKVETGLATLCIGGGQGISMVVSR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtagtaatcgtatcagcagtcagaacacctataggaagttttggaggtgta
tttaaaaatacttcagctgttcaacttggaactatcgctgttaaagaagcgatatcacgt
gtaggacttaatttatctgaaatagatgaagtaataattggaaatgttcttcaaacaggg
cttggacagaatgttgctaggcaaattgctataaattcaggtataccaaattctgttcca
agctacacagtaaataaattatgtggttcagggcttaaaagtgttcagctagctgcccaa
tcaatcacatctggtgaaaatgatgtggtaattgcaggtggtactgaaaatatgagccaa
gctccttatatcgttccaactgctcgctttggtagtaaaatgggtgacataaccatggta
gatagtatgctaacagatggccttattgatgctttcaatcagtatcatatgggaataact
gcagaaaatattgcaactaaatttgaatttactagagaaatgcaagataaattggcatta
gaaagtcaaaataaggctgagaatgctataaaaaacaaccgctttaaagaagaaatcgtt
ccagtagatgttttaatacgtcgaggaaaaatagaaactattgataaagatgaatatcct
aaattaggcatgacatttgaaggtttagctaaacttaaacctgcattcaaaaaagatggt
actgtaacagctggaaatgcctcaggtattaatgatggtgcggctatgttaatactaatg
agccaacaaaaagcagacgaactaggtattagaccacttgctaaaataaaatcctatgct
tcagctggtgttgaacctgaagtcatgggtactggtccaatccctgcaactagaaaagca
ctgaaaaaagctggacttagcatcaatgatatagacttaatagaagcaaacgaagcgttt
gctgcccaagcattagctgttaaaaatgaacttcaaatagattcatcaaagttaaatgtt
aatggtggtgcaatagcattaggacatccaataggagcaagtggagctagaatacttgtt
accttaatttatgaaatgcaaaaacgtaaagttgaaactggacttgcaacactttgtatt
ggtggtggtcaaggaatatcaatggtggtttcacgatag

DBGET integrated database retrieval system