KEGG   Clostridioides difficile CD196: CD196_2556Help
Entry
CD196_2556        CDS       T00997                                 

Gene name
gtaB
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00040  Pentose and glucuronate interconversions
cdc00052  Galactose metabolism
cdc00500  Starch and sucrose metabolism
cdc00520  Amino sugar and nucleotide sugar metabolism
cdc01100  Metabolic pathways
cdc01130  Biosynthesis of antibiotics
Module
cdc_M00362  Nucleotide sugar biosynthesis, prokaryotes
cdc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CD196_2556 (gtaB)
   00052 Galactose metabolism
    CD196_2556 (gtaB)
   00500 Starch and sucrose metabolism
    CD196_2556 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    CD196_2556 (gtaB)
Enzymes [BR:cdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CD196_2556 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: CBA64902
UniProt: A0A0H3N4U8
Position
complement(2974990..2975934)
Genome map
AA seq 314 aa AA seqDB search
MKKKYKYGILIWYNRKFTKKGEKMQMTVKKAIIPAAGLGTRFLPATKSQPKEMLPIVDKP
TLQYIIEEAIESGIEEILIITGRNKKSIEDHFDKSVELELELEQKGKTEMLEMVRDISNM
VNIHYIRQKEPKGLGHAIYCAKSFIGDEPFAVLLGDDIVDSDVPCLKQLIDTYNEYKTTV
LGVQKIAKEDTNKYGILDVKHIEDRVYKVKDMVEKPAIEEAPSDIAILGRYIITPAIFSI
LEKQTPGKGGEIQLTDALQTLGKQEAIYAYNFEGRRYDVGDKIGFLEATIDFALKRENLK
DDLMDYMRKKVSEK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaaagtataaatatggtatattaatttggtacaatagaaaatttacgaagaag
ggtgaaaaaatgcagatgacagttaaaaaagcaataataccagcagcagggctaggaacc
agatttttaccagcaacaaaatcacagcccaaagaaatgcttcctatagtagataaacca
actttacagtatataatagaagaagctatagaatcgggaattgaagaaattcttataata
acaggtagaaataaaaaatctatagaagatcattttgataaatcagttgaattagagtta
gaactagagcaaaaaggtaagacagagatgttagaaatggtaagagacatatcaaatatg
gtaaatattcattatataagacaaaaagagccaaaaggtcttggacatgcaatttactgt
gcaaaaagttttataggtgatgaaccttttgccgtattattaggtgatgatatagtagat
tcagatgttccgtgcttaaaacaattaatagatacttataatgagtataaaacaactgta
ttaggtgttcaaaagatagctaaagaagatactaataaatatggtatattggatgtaaaa
catatcgaagatagagtatataaagttaaagatatggttgaaaaacctgcaattgaagaa
gctccatctgatatagctatacttggaagatatataataactcctgcaatatttagtata
ttagagaaacagacacctggtaaaggtggagagatacaactgacagatgcacttcaaact
cttggaaaacaagaggctatttatgcttataactttgaaggtagaagatatgatgtggga
gataagattggttttttagaggcaacaatagactttgctctaaagagagaaaatttaaaa
gatgatttaatggactatatgagaaaaaaagtaagtgaaaaataa

DBGET integrated database retrieval system