KEGG   Clostridioides difficile CD196: CD196_2982Help
Entry
CD196_2982        CDS       T00997                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00010  Glycolysis / Gluconeogenesis
cdc00051  Fructose and mannose metabolism
cdc00562  Inositol phosphate metabolism
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01120  Microbial metabolism in diverse environments
cdc01130  Biosynthesis of antibiotics
cdc01200  Carbon metabolism
cdc01230  Biosynthesis of amino acids
Module
cdc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cdc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD196_2982 (tpi)
   00051 Fructose and mannose metabolism
    CD196_2982 (tpi)
   00562 Inositol phosphate metabolism
    CD196_2982 (tpi)
Enzymes [BR:cdc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CD196_2982 (tpi)
Exosome [BR:cdc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CD196_2982 (tpi)
  Exosomal proteins of bladder cancer cells
   CD196_2982 (tpi)
  Exosomal proteins of melanoma cells
   CD196_2982 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Creatinase_N
Motif
Other DBs
NCBI-ProteinID: CBA66018
UniProt: A0A0H3N641
Position
complement(3530528..3531271)
Genome map
AA seq 247 aa AA seqDB search
MRKPIIAGNWKMHKTIKEALEFVNEVKDKVNSDKVEAVICAPFTLLKDLKEATKGTNIKI
GAQNMHFEEKGAFTGEVSPLMLKEIDMDYVVIGHSERRQYFNETDETVNKKVLKALEVGI
DPILCVGETLEQREAGKTKDVCKVQVEKALENVLKDDLSKVVVAYEPIWAIGTGKTATAE
DANDVISYIREVIKGLYGELANEVRIQYGGSVKPSNVAEIMGQSDIDGALVGGASLASND
YLDLVNF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaacctataattgcaggaaactggaaaatgcataaaacaataaaagaagcttta
gaatttgtaaatgaagttaaagataaagtaaattctgataaagtagaagctgttatatgt
gcaccatttactttattaaaggatttaaaagaagctactaagggtacaaatataaagata
ggtgctcaaaatatgcactttgaagaaaaaggagcatttacaggagaagtttcacctctt
atgttaaaagaaatagatatggactatgttgtaataggacattcagaaagaagacaatac
ttcaatgaaactgatgaaactgtaaacaagaaagttttaaaagcattagaagtaggaata
gacccaatattatgtgttggagaaactttagaacaaagagaagctggaaaaactaaagat
gtttgtaaagttcaagttgaaaaagctttagaaaatgttcttaaagatgatttatcaaaa
gtagttgttgcatatgagccaatctgggctattggaactggtaaaactgcaactgctgaa
gatgctaatgacgttatatcttatataagagaagttataaaaggattatatggagaatta
gctaatgaagttagaatacaatacggtggaagtgttaaaccttcaaatgtagccgaaata
atgggtcaaagtgatatagatggagctttagtaggtggagctagtttagctagtaatgat
tacctagaccttgttaatttctaa

DBGET integrated database retrieval system