KEGG   Clostridioides difficile CD196: CD196_3212Help
Entry
CD196_3212        CDS       T00997                                 

Definition
(GenBank) putative cobalamin biosynthesis phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00860  Porphyrin and chlorophyll metabolism
cdc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CD196_3212
Enzymes [BR:cdc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     CD196_3212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3461 Cu-oxidase LMBR1
Motif
Other DBs
NCBI-ProteinID: CBA66502
UniProt: A0A0H3N6Q3
Position
complement(3812242..3812856)
Genome map
AA seq 204 aa AA seqDB search
MIRLILIRHALTNDNKKGRLSGHINSCISEEGKLQINKITRYLSNENIDKVYTTPSTRTK
DTVEKISKLKLLEIEEKEALREISFGDFEGRTFEEIKIKYPNEFEKMIKEGNNYRYPNGE
SLIDSYKRVAKEIDNIILENDSNLDTKTILICSHAGTIRNIITHLISGSYKYHWNFKIDN
ASITVLEIDGGFAVIDKMNFTDFI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgataagattaatattaataagacatgcactgacaaatgataataaaaaaggaagatta
tcaggccatataaatagttgtattagtgaagagggcaaactacaaataaataaaattacc
agatatctgagtaatgaaaacatagataaggtttatacaacaccatctacacgtactaaa
gatacagtagaaaaaatatcaaaattgaaattattagaaatagaagaaaaagaagcttta
agagaaattagttttggagactttgaaggaagaacttttgaagaaattaaaatcaaatat
ccaaatgagtttgaaaaaatgataaaagaaggtaacaactatagatatccaaatggagaa
agtttgatagactcttataaaagagtggcaaaagaaattgataatataattttagaaaat
gatagtaatttagatacaaagacaatacttatatgttctcatgcaggaacaataagaaat
ataataacacatttgatttctggtagttataagtatcactggaactttaaaattgataat
gcatctattacagttttagaaattgatggtggatttgctgtaatagataaaatgaatttt
acagacttcatataa

DBGET integrated database retrieval system