KEGG   Clostridioides difficile CD196: CD196_3357Help
Entry
CD196_3357        CDS       T00997                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-c-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cdc  Clostridioides difficile CD196
Pathway
cdc00900  Terpenoid backbone biosynthesis
cdc01100  Metabolic pathways
cdc01110  Biosynthesis of secondary metabolites
cdc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD196_3357 (ipk)
Enzymes [BR:cdc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     CD196_3357 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C TFX_C
Motif
Other DBs
NCBI-ProteinID: CBA66783
UniProt: A0A0H3N725
Position
complement(3964310..3965230)
Genome map
AA seq 306 aa AA seqDB search
MHYSLNKEDRMDFIRLKSRAKINLSIDVLGKRQDGYHFVEMIMQTIDLYDIVKIKELDED
EIKVKSTSLDIPLDEDNIVYKAAKILKNKFYIKKGVEIFIEKNIPVAAGMAGGSSNAAAV
LVGLNHLWELRLSEDELKEIGLNLGADVPFCISGRPALAQGIGEKLTNIKGLPCDTNILI
CKPDLFVSTKEVYQGLDLNNIKKRPNNKYLIECLKSEDIKAVSESMVNILENVTIGKHKE
ISDIKQVMMKNNALGSMMSGSGPTVFGLFKNKEDALIGKKELLKKYKQVYVVNSSQKGVE
ICGEFN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcattattctttaaacaaggaggatagaatggattttataagactaaagagtagagca
aaaataaatttatccattgatgtcttgggaaaaaggcaagacggttatcattttgttgaa
atgataatgcaaacgatagatttatacgatatagtaaagataaaagaattagacgaagat
gaaataaaggtaaaaagcactagtttagatattcctttagatgaagataatattgtttat
aaagctgccaaaatacttaaaaataaattttatataaaaaaaggtgtagaaatattcata
gaaaaaaatattcctgtagcagcagggatggctggaggaagttctaatgcagccgcagta
ttagtaggtttaaatcacctatgggaacttagattatctgaagatgaattaaaagaaata
ggacttaatttgggcgcagatgttcctttttgtatatcaggaagacctgccttagctcaa
ggtattggagaaaagctaacaaacatcaaaggtttaccatgtgatacaaatatattgata
tgcaaaccagacttattcgtttctactaaagaagtttatcaaggattagatttgaataat
attaaaaaaagaccaaataataaatatttgatagagtgtttaaaatctgaagatataaaa
gctgtatcagaaagcatggtaaatattcttgaaaatgttactataggtaaacacaaagaa
ataagtgatataaaacaagtaatgatgaaaaataatgctttaggttctatgatgagtgga
agtggtcctacagtttttggactatttaaaaataaagaagatgctctaattggaaaaaaa
gaattattaaaaaaatataaacaggtgtatgttgttaatagcagtcaaaaaggggttgaa
atttgtggagaatttaactaa

DBGET integrated database retrieval system