KEGG   Clostridioides difficile CD196: CD196_3420Help
Entry
CD196_3420        CDS       T00997                                 

Definition
(GenBank) putative cell wall hydrolase
Organism
cdc  Clostridioides difficile CD196
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lysozyme_like NLPC_P60 DUF1175 SLT CHAP Peptidase_C92
Motif
Other DBs
NCBI-ProteinID: CBA66903
UniProt: A0A0H3N739
Position
4035091..4036098
Genome map
AA seq 335 aa AA seqDB search
MKLRHIAIVGSLFSILFSLVLFFGVLISAEDDDGGNGYSSNYVGMNLSAEVLKHQPMVEK
YAKENGISEYVNVLLVIIQVESGGTAEDVMQSSESLGLPPNSLDTESSIKQGCKYFASLL
SSCKNQGISDINVVIQSYNYGGGYVGYVAGNGKKHMFNLAENFARDKSGGQKVTYTNPIA
VAKNGGWRYGYGNMFYVELVNQYLVVNQVSGELAQKVMNEALKYQGWKYVYGGSNPNTSF
DCSGLVQWCYNKAGVSLPRTAQNQYDATQHIPLSQAKAGDLVFFHSTYNAGSYVTHVGIY
VGNTQMYHAGDPIGYADLNNAYWQQYLICAGRIKQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaagacatatcgctattgttggcagtctgttttctatcctcttttctctcgta
ttattctttggggttctgattagtgccgaggacgacgacgggggcaatggttattcctct
aattatgtaggtatgaacctatctgccgaagtcttgaaacatcagcctatggtagaaaag
tatgccaaagaaaacggtatttccgagtatgtcaatgtgttgctggtaatcatacaagtg
gaaagtggcggtacagccgaggacgttatgcaaagctctgaaagtctgggactaccaccc
aactcactagatacggaaagctcaatcaagcaggggtgtaaatattttgcgtccctgctt
tcttcctgcaaaaatcaaggtatcagtgatataaatgttgtgatacagtcctataactat
ggcggtggctatgttggctatgtggcaggaaacggaaaaaagcatatgttcaaccttgcg
gaaaacttcgcaagggataagtcgggcggtcaaaaagtaacctatacgaaccctatcgcc
gtggcaaaaaatggtggctggcgttatggctatggaaatatgttctatgtggagcttgtg
aaccagtaccttgttgtcaatcaagtatcgggcgagctggcacaaaaggttatgaatgaa
gccttaaaatatcaaggttggaagtatgtatatggtggcagtaacccgaacacttctttt
gattgttcgggactggtacagtggtgctacaacaaagctggcgtatctttaccgagaacc
gcacaaaatcagtatgacgcaacccagcatatcccactatcgcaggcaaaggcaggcgat
ttggtctttttccacagtacctacaatgcaggaagctatgtaacccacgtcggtatctat
gtaggaaacactcagatgtatcatgcaggcgaccctatcggatatgccgatttaaacaat
gcttattggcaacagtacttgatttgtgctggaagaataaaacagtag

DBGET integrated database retrieval system