KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_0907Help
Entry
CDCE8392_0907     CDS       T01700                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K01616  2-oxoglutarate decarboxylase [EC:4.1.1.71]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Brite
KEGG Orthology (KO) [BR:cdd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CDCE8392_0907 (sucA)
Enzymes [BR:cdd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.71  2-oxoglutarate decarboxylase
     CDCE8392_0907 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEX71900
Position
complement(920330..924043)
Genome map
AA seq 1237 aa AA seqDB search
MSSASTFGQNDWLVDEMFQQFQKDPQSVDKEWRDLFEKQGAPSTPGTEAKNTSPQPAAPA
KKQPAPAKKPAPTTASAPASTEAKAAPKPENKKPAKKQQPSPLERTGELPAAGSSAIKGI
YKAIAKNMDESLEVPTATTVRDMPVKLMWENRSIINEHLKRTTGGKVSFTHIIGYAVAKA
TMAHPDMNNYYEVVDGKPTLNTPEHINMGLAIDVQQKSGARALVVAAIKEAETLSFAEFV
AKYEDIVARSRVGKLTMDDYSGVTISLTNPGGIGTRHSVPRLTKGQGAIIGVGSMDYPAE
FAGASADRLAELGVGRLVTITSTYDHRIIQGAESGEFLRTMSQLFIDDAFWDEIFESIGI
PYAPMRWASDLSNTGIDKNTRVMQLIEAYRSRGHLIADTNPLRWHQPGMPVPDHRDLDIA
THGLTLWDLDRSFNVGGFGGKETMTLREVLGRLRAAYTLKVGSEYTHILDRDERLWLQDR
IEAGMPKPSYAEQKYILQKLNAAQAFEDFLQTKYVGQKRFSLEGAEALIPLMDSAIDTAA
GQGLDEVVIGMPHRGRLNVLVNIVGKPLATVFTEFEGHIEPKAAGGSGDVKYHLGAEGTH
IKMFGDNEIKVSLAANPSHLEAVDPVMEGIARAKQDLLNKGDSTDGYSVVPMMLHGDAAF
AGLGIVQETLNLAQLRGYTVGGTIHIIVNNQIGFTTTPDSGRSSHYATDLAKAYGCPVFH
VNGDDPEAVVWVGRLATEYRRQFGKDVFIDMISYRRRGHNEADDPSMTQPEMYKLIDARN
TVREQYKEDLLGRGELTTEDAEKVQRDFHDQMESIFNDVKETEKKPFEAQAGITSSQEVP
HGLETNITREELVEIGQAYATAPENFEFHQRVAPVAKKRLEAAQNGGIDWGWGELIAFGS
LAAGGKFVRLAGEDSRRGTFTQRHAVVYDPRTGEEFNGLNDLAERKGNGGKFLVYNSALT
EYAGMGFEYGYSVGNEDAVVAWEAQFGDFANGAQTIIDEYISSGEAKWGQTSSVILLLPH
GYEGQGPDHSSARIERYLQLCAEGTMTVAQPTTPANYFHLLRRHVLGGLKRPLVVFTPKS
MLRMKAATSSVEDFTQMKKFQSVINDPRFVNGGLDKNKVKKIMLVSGKLYYDLAKRAQKD
KRDDVAIVRIEMLHPIPFNRLKEAFDFYPNAEEIRFCQDEPANQGPWPFLHEHLPELIPG
MLPMKRVSRRAQASTATGLSKVHAVEQQHLLDEAFAD
NT seq 3714 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgctagtactttcggccagaacgattggctggtagacgagatgttccagcag
ttccaaaaggatccgcagtccgtagataaggaatggcgcgaccttttcgagaagcagggt
gccccgagcacaccgggaactgaggctaagaacacctccccacagccagccgcccccgca
aagaagcaaccagcaccggccaagaagccagcaccaactacggcttctgccccagcttcc
accgaagctaaggctgcaccaaagccagagaacaagaagcctgccaaaaaacagcagcct
tccccactcgagcgcacaggcgagctgcccgcagctggttcctccgcaatcaagggcatt
tacaaggcaattgctaagaacatggacgagtcgctcgaggttcctaccgcgaccaccgtt
cgcgatatgccagtaaagctgatgtgggagaaccgctccattatcaacgagcacctcaag
cgcaccaccggtggcaaagtctcctttacccacatcatcggctacgcagtggccaaagca
accatggcccaccccgatatgaacaactactacgaagttgttgacggcaagccaactctc
aacaccccagagcacatcaacatgggtttggctatcgacgtccagcaaaagtccggtgcc
cgcgcactggtcgttgctgccattaaagaagccgaaacgctttccttcgccgagttcgtc
gctaagtacgaggacatcgtggcacgctcccgtgtgggcaagctcacgatggatgattac
tccggtgtgaccatctctttgaccaacccaggtggcattggtacccgtcactccgtacct
cgtcttaccaagggccaaggcgccatcatcggcgttggttccatggattacccagctgaa
ttcgcaggtgcatccgcagaccgcctcgcagagctaggtgttggccgcttggtcaccatc
acctctacgtacgatcaccgcatcattcagggtgcggaatccggtgaattcctgcgcacc
atgagccagctatttatcgatgatgccttctgggatgagatcttcgaatccatcggtatc
ccttacgcaccgatgcgctgggcttctgatctttctaacacgggaatcgataagaacacc
cgcgtgatgcaactcatcgaggcataccgctcccgtggacacctcattgcagacacaaac
ccattgcgctggcaccagccaggcatgccagtcccagaccaccgcgatctagacatcgcc
acgcacggtcttaccctgtgggaccttgatcgatctttcaacgttggtggcttcggcggc
aaggaaaccatgacactgcgcgaggtgctcggtcgcctccgcgccgcctacaccctcaaa
gtgggctcggaatacacccacattctcgaccgcgatgaacgcctctggttgcaagatcgc
atcgaagcgggcatgccgaagccttcctacgctgagcagaagtacatcctgcagaaactc
aacgcggcacaggctttcgaggacttcctccaaaccaagtacgttggccaaaaacgtttc
tccctagaaggcgccgaggcactgatcccgctgatggactctgccatcgacaccgccgca
ggccaaggcctcgacgaagttgttatcggtatgccacaccgcggccgcctcaatgtgctg
gtcaacatcgtgggcaagccacttgcaaccgtattcaccgaattcgaaggccacatcgag
ccaaaggctgccggtggatctggcgacgtgaagtaccacctcggtgctgagggcactcac
atcaagatgttcggcgacaacgaaatcaaggtttcgcttgccgctaacccatctcacctc
gaagcagtcgaccccgttatggaaggtattgcccgcgcaaagcaagacctcctcaacaag
ggtgactccactgacggctactccgttgttcctatgatgttgcacggcgacgctgcattc
gcaggacttggcatcgttcaagaaaccttgaacctcgcccagctgcgtggctacaccgtc
ggcggcaccattcacatcatcgtgaacaaccagatcggcttcaccaccaccccagactcc
ggccgctctagccactacgccaccgaccttgccaaggcctacggctgccctgtcttccac
gtcaacggtgacgatccagaagcagtggtatgggttggacgcctcgctaccgagtaccgt
cgccaattcggcaaagacgtcttcatcgacatgatctcctaccgtcgtcgcggccacaac
gaagccgatgacccatcgatgacgcagccagagatgtacaagctgatcgacgcccgcaac
accgtgcgcgaacagtacaaggaagacctcctaggccgtggcgagctgaccaccgaggac
gccgaaaaggtacagcgcgatttccacgaccagatggaatccatcttcaacgatgtcaag
gaaaccgaaaagaagccattcgaggcacaagctggcatcacttcctcccaagaagttcca
cacggccttgaaaccaacatcacccgtgaagaactcgtagaaatcggtcaggcctacgcc
acagcaccagaaaacttcgagttccaccagcgcgtagcaccagtagcaaagaagcgcctc
gaggcagctcaaaacggtggcattgactggggttggggcgagctcatcgccttcggctcc
ctcgcagcaggcggcaagttcgttcgcctcgcaggtgaagattcccgacgcggcaccttc
acccagcgccacgcagtggtctacgatccacgcaccggtgaagagttcaacggcctcaac
gaccttgctgagcgcaagggcaacggcggtaagttcctcgtgtacaactccgccctgacc
gaatacgctggcatgggcttcgaatacggctactccgtaggtaacgaagatgccgtcgtc
gcatgggaagcacagttcggtgactttgccaacggcgcccagaccatcatcgacgaatac
atctcgtccggtgaggccaagtggggccagacgtcctccgtgatccttcttctgccacac
ggctatgaaggacagggccctgaccactcctccgcacgtattgagcgctacctgcagctc
tgcgctgaaggaaccatgaccgtggcacagccgaccaccccagccaactacttccacctc
ctacgccgccacgtactcggcggactgaagcgaccactcgtcgtattcacgccaaagtcc
atgctgcgtatgaaggctgcaacctcaagcgtggaagacttcacccagatgaagaagttc
cagtccgtcatcaacgacccacgcttcgttaacggcggattggacaagaacaaggtcaag
aagatcatgctggtttccggcaagctctactacgaccttgctaagcgagcacaaaaagac
aagcgtgacgacgtagccatcgtccgcatcgaaatgctccacccaatcccattcaaccgt
ctcaaagaagccttcgacttctacccgaacgccgaagaaatccgcttctgccaagacgaa
ccagcaaaccaaggcccatggccattcctgcacgagcacctaccagagctcatcccaggc
atgctgccaatgaagcgcgtctcccgtcgcgcacaggcctccaccgccaccggcctatcc
aaggtccacgcagtggaacagcagcacttgctcgacgaagcattcgctgactaa

DBGET integrated database retrieval system