KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1153Help
Entry
CDCE8392_1153     CDS       T01700                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00670  One carbon pool by folate
cdd01100  Metabolic pathways
cdd01120  Microbial metabolism in diverse environments
cdd01200  Carbon metabolism
Module
cdd_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:cdd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CDCE8392_1153 (fhs)
Enzymes [BR:cdd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CDCE8392_1153 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS NVEALA
Motif
Other DBs
NCBI-ProteinID: AEX72146
Position
complement(1210042..1211694)
Genome map
AA seq 550 aa AA seqDB search
MPTDVEIAQAHTLEPITDIANRAGVPSDALIPYGFTKAKIDINRIASENTGKLVLVTGIS
PTPAGEGKSTVLIGLSDAMRLRGHNSIVAIREPSLGPVMGIKGGAAGGGYSQIVPMEDIN
LHFTGDFHAITAANNTLAAMIDNHIHQGNTLGIDVRRITWQRCLDVNDRSLRKVVTGLGG
KPHGVPTETGFTITAASEIMAILCLAADLTDLEARLARIVVGQTFSGEPVTVGQLNAQGA
LAALLRDAVNPNLVQTLGGTPALCHGGPFANIAHGCNSLIATKTALSLGDVVLTEAGFGS
DLGAEKFFDIKSRVGDLNVAATVVVATVRSLEYNAGVPKDELTTENLEALASGVVNLERH
VENIRAFGIEPIVALNKFASDTDAEINQLKAWAETMSVQLIPVEVWAHGGQGALELADAV
AVSMQNQTSHHLYDPELGIEASLLTIAQKIYGAADVELSKQARQDLAYLQENGWDRLPVC
ISKTQYSFSDDPSQLGRPEGHTLHVRNLLPRIGAGFIVALTGDVMTMPGLPKKPAAENIG
VENGEIKGLF
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgacggacgttgaaattgcccaagctcataccctcgagcccatcactgacattgcc
aatcgagctggagtaccttccgatgctctgatcccttatggctttacaaaagcgaaaata
gatattaatcggattgcgagcgaaaacactggaaaactcgtgctcgtgacagggatttca
ccaacgcctgccggcgaaggcaaatcgactgtcctcattggtctttcggacgcaatgcgg
ctacgcggccataattctattgttgctattcgcgaaccttctctaggccccgtaatggga
attaaaggtggagccgcaggtggtggatattcacagatcgtccctatggaagacatcaat
ctgcatttcaccggagactttcatgcaatcacagcagctaacaatacgctggcagcaatg
attgacaatcatattcatcaaggcaatactctaggaattgatgtccgtcggattacttgg
caacgttgcttggatgtaaacgaccgctctttgcgcaaagttgtgactggcctaggtggt
aaaccgcatggagtgccaactgaaacaggattcacgattacagccgcgagtgaaatcatg
gcgattctatgtctggcagcagatctaacagatttggaagcacgcttggcacggattgtc
gtaggccagacatttagcggtgaaccagttaccgttggtcaacttaatgcgcaaggagca
cttgcagcgttgcttcgtgatgcagttaatccaaatttagttcaaacattgggtggaaca
cctgcgttgtgccatggtgggccattcgcgaatattgcccatgggtgtaactctcttatc
gctacaaaaacggcgctgtcactcggagatgtcgtactgacggaagcaggattcgggtcc
gacctcggtgccgaaaaattcttcgatattaagtcgcgcgtaggtgacctcaatgttgct
gcaaccgtcgttgtcgcaactgtaaggtctcttgaatacaacgccggcgttcctaaagat
gagctcacaaccgaaaaccttgaagctcttgcatctggagtcgtcaatctcgaacggcac
gttgaaaatattcgtgcgtttggtatcgaaccaattgttgcactgaataaatttgcctcg
gacactgatgcagaaatcaatcagctcaaagcttgggctgaaaccatgtcggttcaattg
atcccagtcgaagtttgggctcatggtgggcaaggcgcgctagaacttgccgacgcagtt
gcagtctcgatgcaaaatcaaacttcgcatcacctttatgaccccgaactgggaattgaa
gcatcactgctcacaattgcgcaaaaaatctacggcgcggcagatgttgagttgtcgaag
caagcgcgtcaagatctggcatatttgcaagaaaatggatgggatcgcttgccagtatgt
atttccaagacacaatattcgttcagtgatgatccatctcagctagggcgtccagaagga
catactcttcacgttcgcaatttattgccacgaatcggtgcaggatttatcgttgctctt
accggtgatgtcatgaccatgcctggccttccgaaaaaaccagccgctgaaaacatcgga
gttgaaaatggagagatcaaaggccttttctaa

DBGET integrated database retrieval system