KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_1411Help
Entry
CDCE8392_1411     CDS       T01700                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00020  Citrate cycle (TCA cycle)
cdd00620  Pyruvate metabolism
cdd01100  Metabolic pathways
cdd01110  Biosynthesis of secondary metabolites
cdd01120  Microbial metabolism in diverse environments
cdd01130  Biosynthesis of antibiotics
cdd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDCE8392_1411 (mqo)
   00620 Pyruvate metabolism
    CDCE8392_1411 (mqo)
Enzymes [BR:cdd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CDCE8392_1411 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 FAD_binding_3 K_oxygenase HI0933_like Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: AEX72399
Position
complement(1479612..1481111)
Genome map
AA seq 499 aa AA seqDB search
MADSTTAQQVTDEVDVALIGAGIMSATLGAMLRTLEPGWTQVMFERLDAPAQESSSPWNN
AGTGHSALCELNYTPEVKGRVQIDKALGVNEKFQISRQFWSYQVNEGVLPSPREWINPVP
HVSFGRGEDQVAYLKKRYEALAAHPLFPNMQYTDDRAKFAEMLPLMADGRSEFEKVAISW
TDAGTDINYGSQTRQFLKAAEKNGTEIRYGHEVKDIKRDGAKWRVTVKNIHTGDTQVIRA
NFVFVGAGGMALPLLQKTGIVEIRGWGGFPVSGQWLRCTNPDIIEQHAAKVYGKASIGAP
PMSVPHLDTRVIDGEKGLLFGPYAGWTPKFLKKGSYLDLFKSIRPTNLMSYLGVGAQEFG
LTKYLITEVMKDQAARMESLREYMPNAKDEDWELVTAGQRVQAIQPVVGPRFSTLAFGTS
LINSADGSVAGILGASPGASIAPAAMLELLERCFGQKMVEWGPTIKDMIPSYGIRLATDQ
KLFNEIWDHTQATLQLDKK
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcagactccaccacagcgcaacaagtcaccgacgaggtcgatgttgcgctcatcggt
gccggcattatgagcgctacgttgggtgcaatgcttcgcaccctggaacctggttggacc
caggttatgttcgagcgcttggatgcccccgcgcaagaatcttcttcaccttggaataac
gcaggtacaggtcactcggcactatgcgagctgaactacacgcctgaggtgaaggggcgg
gtacaaattgacaaggctttgggtgttaacgaaaagttccaaatttctcgtcagttttgg
tcttaccaagtaaatgaaggcgttttgccttcgccacgtgagtggatcaacccagttcca
cacgtatccttcggacgtggcgaggatcaagttgcttatttgaagaagcgttacgaggca
cttgctgcgcaccctttgttcccgaacatgcaatacacggatgaccgtgccaagttcgct
gaaatgctgccgcttatggctgatggtcgtagcgagtttgaaaaagttgctatttcatgg
accgacgctggtacggacatcaactatggttcccagacgcgtcaattccttaaagccgca
gagaaaaatggtaccgagatccgttacgggcacgaagttaaagacatcaagcgtgatggt
gctaagtggcgtgtgacggtcaagaatattcataccggagatacccaagttattcgcgct
aactttgtgtttgttggtgctggcggcatggcattgccattgctgcagaaaacgggcatt
gtggaaatccgtggttggggcggcttcccagtttcgggtcagtggctacgatgcactaat
cctgacattattgaacagcatgctgccaaggtttatggcaaagcatcaattggtgcgcct
ccaatgtcggttccacaccttgacacccgtgtgatcgacggcgaaaagggcttgctgttt
ggcccttatgctggttggactccgaagttcttgaagaagggctcctatttggatctcttt
aagtcgattcgtccgaccaacttgatgtcctacttgggtgttggtgcacaagagttcggt
cttaccaagtacctcatcacggaggtcatgaaggatcaggctgcgcgcatggaatcgctg
cgtgaatacatgcctaatgcaaaggatgaggattgggagctggtcactgctggtcagcgt
gtgcaggcaattcagcctgttgttggtcctcgattctcgactcttgcgtttggtacttca
ttgatcaactctgctgacggctccgtagcgggaatcttgggtgcctcgcctggtgcgtct
atcgctccagctgcaatgcttgagctgctcgagcgctgcttcggtcagaagatggtggaa
tggggtccaacgatcaaagacatgatcccttcatatggtatccgtttggcaacggatcag
aagctcttcaacgagatctgggatcacacccaagcaactttgcagcttgataagaagtaa

DBGET integrated database retrieval system