KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2032Help
Entry
CDCE8392_2032     CDS       T01700                                 

Definition
(GenBank) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00071  Fatty acid degradation
cdd00280  Valine, leucine and isoleucine degradation
cdd00310  Lysine degradation
cdd00362  Benzoate degradation
cdd00380  Tryptophan metabolism
cdd00620  Pyruvate metabolism
cdd00630  Glyoxylate and dicarboxylate metabolism
cdd00640  Propanoate metabolism
cdd00650  Butanoate metabolism
cdd00900  Terpenoid backbone biosynthesis
cdd01100  Metabolic pathways
cdd01110  Biosynthesis of secondary metabolites
cdd01120  Microbial metabolism in diverse environments
cdd01130  Biosynthesis of antibiotics
cdd01200  Carbon metabolism
cdd01212  Fatty acid metabolism
cdd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDCE8392_2032
   00630 Glyoxylate and dicarboxylate metabolism
    CDCE8392_2032
   00640 Propanoate metabolism
    CDCE8392_2032
   00650 Butanoate metabolism
    CDCE8392_2032
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CDCE8392_2032
   00072 Synthesis and degradation of ketone bodies
    CDCE8392_2032
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CDCE8392_2032
   00310 Lysine degradation
    CDCE8392_2032
   00380 Tryptophan metabolism
    CDCE8392_2032
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CDCE8392_2032
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CDCE8392_2032
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CDCE8392_2032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdd04147]
    CDCE8392_2032
Enzymes [BR:cdd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CDCE8392_2032
Exosome [BR:cdd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CDCE8392_2032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEX73015
Position
complement(2151563..2151772)
Genome map
AA seq 69 aa AA seqDB search
MNRSFDRSPPYHTGGVQINRFCAAGLSAINLAAQKVRSGMDELVLAGGVESMSRVPMMSD
GGALPCSRS
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcagctttgaccgctcgccgccttaccacaccggcggcgtgcagattaaccgt
ttctgcgccgccggcctgtccgccatcaacctagcagctcaaaaggtccgctctggcatg
gacgaacttgttctcgccggcggcgtggagtccatgtcccgcgtaccaatgatgtccgat
ggcggtgctctcccatgctcgcgcagctaa

DBGET integrated database retrieval system