KEGG   Corynebacterium diphtheriae CDCE 8392: CDCE8392_2249Help
Entry
CDCE8392_2249     CDS       T01700                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cdd  Corynebacterium diphtheriae CDCE 8392
Pathway
cdd00260  Glycine, serine and threonine metabolism
cdd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cdd01100  Metabolic pathways
cdd01110  Biosynthesis of secondary metabolites
cdd01130  Biosynthesis of antibiotics
cdd01230  Biosynthesis of amino acids
Module
cdd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cdd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CDCE8392_2249 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CDCE8392_2249 (trpB2)
Enzymes [BR:cdd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CDCE8392_2249 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEX73232
Position
2409845..2411071
Genome map
AA seq 408 aa AA seqDB search
MKHTLLPAYFGEFGGQYVPESLIPALDQLEAAFVEAQNDPEFRAELAGYLKDYLGRPTPL
TLCSKLPKAGKGKGHARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGAGQH
GTATALACALLDLDCVIYMGAKDVERQQPNVYRMELMGAKVVPVDSGSGTLKDAVNEALH
DWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQILEQTGALPDVVVACVGGGS
NAIGMFADFIDDPSVELVGAEPGGMGLSSGKHGATINNGQIGILHGTRSYLMRNSDGQVE
ESYSISAGLDYPGVGPQHAHLAKSGRARYVAITDAEALEAFQLLSREEGIIPALESSHAL
AYALKRAALAEENNEDITIVVSLSGRGDKDIDHIRRTLSAHPELVVKD
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacactgctaccggcatacttcggagaattcggcggacaatacgtacccgag
tcccttatccccgccctcgaccaattagaagcggccttcgtggaagcgcaaaacgatccc
gagtttagagccgaactcgccggctacctcaaggactacctcggtcgtcccacgccgctc
acgctctgctccaagctacccaaagccggaaaagggaaggggcacgcgcggatcttcctc
aaacgagaagacctcgttcacggcggcgcacacaaaaccaaccaagtaatcggccaagcc
cttttagctaaacgcatgggtaaaacccgcattattgctgaaaccggtgctggacaacac
ggaaccgccaccgcactcgcatgcgcactgctcgacctcgactgcgtgatctacatgggc
gctaaagacgtggaacgccaacaacccaatgtgtaccgcatggagctcatgggcgccaag
gtcgtaccagtcgactccggctccggaaccctcaaagatgcagtcaacgaagcactgcac
gattggaccgcaaccttccacgagtcacactatctgcttggcaccgcagccgggccacac
ccatttcccacgattgtgcgcgaattccaccgcgtaatctcagaagaagccaaagcccaa
atacttgagcaaaccggcgcactgccagatgtggtggttgcctgcgtcggcggtggatcc
aacgccatcggcatgttcgccgactttatcgacgacccctcagtagaactcgtcggcgca
gaaccaggtggaatgggactaagctccggaaaacacggcgctaccatcaacaacggccaa
atcggtattttgcacggcaccagaagctacctcatgcgcaactccgatggccaagtagag
gaatcctattccatttcagccggcctcgactacccaggtgtcggcccacaacacgcccat
ctagcaaagtctgggcgcgcccgctatgtcgccatcactgatgcggaagcactcgaagca
ttccaattgctctcccgcgaagagggcatcatcccggccttggaatccagccacgctctt
gcctatgcgctcaaacgtgccgccctcgctgaggaaaacaacgaagatatcaccatcgtg
gtgtccttgtctggccgtggcgacaaagacatcgaccacatccgccgcactctttccgcc
cacccagagctggttgtaaaggactaa

DBGET integrated database retrieval system