KEGG   Corynebacterium diphtheriae HC02: CDHC02_0352Help
Entry
CDHC02_0352       CDS       T01694                                 

Gene name
hemD
Definition
(GenBank) uroporphyrin-III C-methyltransferase / uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00860  Porphyrin and chlorophyll metabolism
cde01100  Metabolic pathways
cde01110  Biosynthesis of secondary metabolites
cde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CDHC02_0352 (hemD)
Enzymes [BR:cde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CDHC02_0352 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CDHC02_0352 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase ECH_1
Motif
Other DBs
NCBI-ProteinID: AEX75848
Position
349299..350969
Genome map
AA seq 556 aa AA seqDB search
MRLIMKPEHSTRGRVIFVGAGPGNPDLLTVRAREVLGSTANAVVDSTVGVGIRAVIAEHL
EVPQAKLDAAEAEYERMCAAAKRRKPPRPDAPTAAEITEVSADASVDEVMAVLLPLLDEG
DVIRLVQGNPLADSRALDEITAVTQVGADFQIVPGMSLPAAVPAFAGITLGDSYTKTTVS
EDTNWDQLATAPLPLILQASKDDLLTIATELKDRKLPASTPVTVTMNGTTRLQRSFDVTL
KTMKSLVKQELDGTLVVTVGVSDRSTFSWWESRALFGWRVLVPRAKDQAGPMSSRIAAYG
AIAQEVPTISVEPPRNPAQLERAIKGIVEGRYQWVVFTSVNAVKAVREKIVSFGLDSRAF
AGVHIAAVGAKTAAAIREFGITPELIPPRKEHNAAGMVSVFPNYVEGLDPVGRVLLPRAD
IATDVLVDGLVNLGWEVDDVVAYRTVRAAPPSAEVRDMIKSGDFDAVCFTSASTVRNLVG
IAGKPHARTIIACIGPMTAAEAEKQGLRVDVIPEVANVAALVDALAEHVEKLRAAGELPP
PRKKRRARRKSKEGAV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgcgattaatcatgaagcccgagcactcaacgcgaggacgtgtcatcttcgtcggcgcc
ggtcccggcaacccagatcttttgacggttcgagcccgcgaggtgctgggctccacagcc
aatgcagtggtggattccactgttggcgtaggtattcgcgcagttattgctgaacatctt
gaggtgccgcaggccaagcttgatgcagctgaggctgagtatgagcgcatgtgtgcggct
gcgaagcgtcgtaagcctccgcgtcccgacgcccccaccgccgcggaaatcactgaggtg
tccgctgatgcgagcgtcgatgaagtgatggcggtgctgttgcctttgctagacgaaggc
gatgtgatccgcctagtgcagggtaacccgttggcggattcccgcgcgttagatgagatt
acggctgttacacaggtgggcgcggatttccagattgtgccaggtatgtcgttgccggct
gcggttcctgctttcgcgggtattacgttgggtgattcttataccaagaccacggtgagt
gaggatactaactgggatcagttggcaaccgccccgctgccgttgattttgcaggcgagt
aaagacgacttgctgactatcgctacggagttgaaggatcgcaaactgccggcgagcact
ccggtgacggtgacgatgaatggcacgacgcgtttgcagcgtagctttgacgtgacgctt
aaaactatgaagtcgctggtcaaacaggagctcgatggcacccttgtggtcacagtgggt
gtatcggatcgcagtacattttcgtggtgggaaagccgcgcgttgtttggctggcgggtg
ttggttccccgtgcgaaggatcaagctggtccgatgagcagccgaatcgccgcttatggt
gctattgcccaagaggttcccactatttctgtggagccgccgcgtaatccggcgcagttg
gagcgtgcgattaagggcattgtggagggacgctaccagtgggtggtgtttaccagcgtg
aatgctgttaaagcggtgcgtgagaagatcgtgtcgtttggtttggattctcgcgcgttc
gcgggggtgcatatcgctgcggtgggggctaagactgcggcggcgattcgtgagtttggc
attactcctgagctaattccgccacgtaaggagcataatgctgcgggtatggtgtcggtt
ttccctaattatgtggagggcttggaccccgtaggtcgagtgttgctgccgcgggctgat
attgccactgacgtgctggttgatggtttggtcaaccttggctgggaagttgatgatgtg
gtggcgtatcgtacggtgcgtgccgcgccgccgagtgcggaagtccgcgacatgattaag
tctggcgattttgatgcggtgtgttttacctctgcgtcgacggtgcgcaatttggtgggt
attgcgggtaagccgcatgcgcgcacgatcattgcatgtattgggccgatgaccgccgcg
gaggcagagaagcaagggctgcgtgtcgacgtcatccccgaggtggctaacgttgcggct
cttgtggatgcgctcgcggagcatgtggagaaactgcgtgctgcgggtgagttgccgccg
ccgcgtaagaagcgtcgggcccgtcgcaaatctaaggaaggtgctgtatga

DBGET integrated database retrieval system