KEGG   Corynebacterium diphtheriae HC02: CDHC02_1305Help
Entry
CDHC02_1305       CDS       T01694                                 

Gene name
ppgK
Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00010  Glycolysis / Gluconeogenesis
cde00520  Amino sugar and nucleotide sugar metabolism
cde01100  Metabolic pathways
cde01110  Biosynthesis of secondary metabolites
cde01120  Microbial metabolism in diverse environments
cde01130  Biosynthesis of antibiotics
cde01200  Carbon metabolism
Module
cde_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC02_1305 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC02_1305 (ppgK)
Enzymes [BR:cde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CDHC02_1305 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEX76797
Position
1394998..1395759
Genome map
AA seq 253 aa AA seqDB search
MIRMENIGFGIDVGGSGIKGARVNLDTGEFVGDRIKILTPKPATPDAVAETIKRILDQAE
WEGPVGITLPSVIHEQRALTAANIDPSWIDVDVNELFARHLGDTEVSVLNDADAAGLAEA
QFGDPIAREGSVILLTFGTGIGSAFLVNGTLFPNTELGHMLVDGEEAEKIASSAAKDRDE
IGYGKWAKRVSKVLNEYERLFWPSAFIVGGGISRKAEKWVPRLTVNTKVVPAQLRNTAGI
VGAAMAASQNLHP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcatggaaaacatcggattcggtatcgacgttggcggctctggtatcaaggga
gcgcgcgtgaatctagacacaggagaatttgtaggagatcgtatcaagattcttactcct
aaacctgcaacccccgatgcagtcgccgaaacaatcaaacgcatcctcgatcaagccgaa
tgggaagggcctgtcggcattactctaccttccgtcattcacgaacaacgagccctcacc
gccgccaatatcgacccatcgtggattgatgtagacgtaaatgagctatttgctcggcac
ttaggcgacaccgaagtttcggttctcaatgacgccgacgctgcgggattggcagaagcc
caatttggcgatcccattgcacgtgaaggaagtgtaatccttctaacctttggtacaggt
ataggttcagcattcttagtcaacggtacgttgtttcccaacactgaactgggccacatg
cttgtagatggcgaagaagcagaaaaaatcgcatcgtctgcagccaaagatcgcgatgaa
attggatacggaaagtgggctaagcgcgtatcgaaggtgctcaacgaatatgagcggctc
ttttggccatcagcttttatcgtcggtggtggcatctcccgtaaagctgaaaagtgggta
cctcgtctcaccgttaacaccaaggttgtcccagcccagctaagaaacaccgctggaatc
gtaggagctgccatggcagcatcccaaaatcttcacccctaa

DBGET integrated database retrieval system