KEGG   Corynebacterium diphtheriae HC02: CDHC02_1504Help
Entry
CDHC02_1504       CDS       T01694                                 

Gene name
glk
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cde  Corynebacterium diphtheriae HC02
Pathway
cde00010  Glycolysis / Gluconeogenesis
cde00052  Galactose metabolism
cde00500  Starch and sucrose metabolism
cde00520  Amino sugar and nucleotide sugar metabolism
cde00521  Streptomycin biosynthesis
cde01100  Metabolic pathways
cde01110  Biosynthesis of secondary metabolites
cde01120  Microbial metabolism in diverse environments
cde01130  Biosynthesis of antibiotics
cde01200  Carbon metabolism
Module
cde_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CDHC02_1504 (glk)
   00052 Galactose metabolism
    CDHC02_1504 (glk)
   00500 Starch and sucrose metabolism
    CDHC02_1504 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CDHC02_1504 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CDHC02_1504 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CDHC02_1504 (glk)
Enzymes [BR:cde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CDHC02_1504 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase TCR Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: AEX76993
Position
complement(1617101..1618054)
Genome map
AA seq 317 aa AA seqDB search
MTNMSESVTVGFDIGGTNMRAAAVTDSGLIIDSVSVPTPKSSEALEKGIISLVAQLREKH
EVSAVGLAVAGFLDPDCEIVRFAPHLPWRDRPVRAELEDALGLPVRLEHDANSAAWGEYR
FGAARGSQNWVLFAVGTGIGATLMHEGEIYRGAFGTAPEFGHLTVVPQGRQCSCGKSGCL
ERYCSGTAIEATARELLDADRGRDSMVAAAYHSGTLSGKTVTEAARQGDVFAIEVFDDFA
EWMGRALSIVCDVLDPGQIVIGGGLSTSSDLFLEKATQHMAQQIVGAGYRPLPTVVCAEL
GGDAGMIGVSDLARRRV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatatgtcagaatctgtcactgtcggattcgacatcggtggaaccaatatgcgg
gcagcggcggtgacggattccggtttgatcatcgactccgtttcggttcctacccctaaa
tcttctgaggctctggaaaaaggcattatttctctggtagctcaattgcgggaaaagcat
gaggtttcggctgtaggtcttgccgttgcaggttttttggatcctgattgcgaaatcgtt
cgctttgctcctcatctgccgtggcgtgatcgcccagtgcgtgcggaattagaggacgcg
ttgggacttcctgttcgtcttgaacatgatgcgaattctgcagcgtggggagaataccgc
ttcggagcggcacgtggttcgcaaaactgggtcttatttgcggttggcactggtatcggt
gccacactgatgcatgagggtgagatctaccgtggtgcttttggtacagctcctgagttc
ggccaccttaccgttgtccctcaaggtcggcagtgttcttgtggcaagagtggctgtttg
gaacgttattgttccggcactgctattgaagcgacagcgcgtgagcttctcgacgccgat
cgtggccgcgactcgatggttgctgctgcttatcattcgggcacattgagtgggaaaact
gtgaccgaagcggcccgccagggtgatgtttttgccatcgaggtctttgatgattttgct
gaatggatgggccgcgccttgtctatcgtgtgtgatgttttagatccgggacagatcgtg
attggtggcgggttgtccacgtcaagcgatttgttcttggaaaaggctactcagcacatg
gcacagcagattgtcggggctgggtatcgcccccttccgacggtggtgtgtgccgaattg
ggtggcgatgccggtatgatcggggtatctgatctggctcggcgtcgcgtctag

DBGET integrated database retrieval system