KEGG   Clostridioides difficile 630: CD630_04450
Entry
CD630_04450       CDS       T00487                                 

Gene name
oraS
Definition
(RefSeq) D-ornithine aminomutase S component
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00472  D-Arginine and D-ornithine metabolism
cdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CD630_04450 (oraS)
Enzymes [BR:cdf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CD630_04450 (oraS)
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-GeneID: 4913891
NCBI-ProteinID: YP_001086916
UniProt: Q188N8
Position
528966..529340
AA seq 124 aa
MKKREDDFEVRRKHLQELSDDELKERFWSLATQIVEPMIELGKKNTTPSIERSVLLRMGF
SSLEVKPILEGVMERGLIGKGAGHVVYKLAKSKNITVREAGLLLVKGEYWDEVTCLFREG
VESC
NT seq 375 nt   +upstreamnt  +downstreamnt
atgaaaaaaagagaggatgattttgaagttagaagaaaacatcttcaagaactgagtgat
gatgagttaaaagaaaggttttggagtttagctacccagatagtagaaccaatgatagaa
cttggtaaaaagaatacaacaccatcaatagaaaggtctgtcttgttgagaatgggattt
tcttctcttgaagtaaaacctattttagaaggggttatggaaagaggtcttataggtaaa
ggagcagggcatgtagtttataaattggctaaatctaaaaatataacggttagagaagca
ggtttgttattagttaagggtgaatattgggatgaagttacatgtttatttagagaaggg
gtagaatcatgttaa

DBGET integrated database retrieval system