KEGG   Clostridioides difficile 630: CD630_04460
Entry
CD630_04460       CDS       T00487                                 

Gene name
oraE
Definition
(RefSeq) D-ornithine aminomutase E component
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00472  D-Arginine and D-ornithine metabolism
cdf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    CD630_04460 (oraE)
Enzymes [BR:cdf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     CD630_04460 (oraE)
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-GeneID: 4913892
NCBI-ProteinID: YP_001086917
UniProt: Q188N7
Position
529334..531538
AA seq 734 aa
MLKENKKLDIDYILKDLDKYKPKRRGWVWREHLENLEMGPFKYKDCTKPLKKSVGLPSSK
YFNNIDPQPSPVITTEIASGRFEDDIRRMRMAAHHGADHLMVIRTAGQSHFDGLIEGTPQ
GIGGVPITRKQVRAQRKALDFIEEEVGRPINYHSYVSGVAGPEVAVMFAEEGVNGAHQDP
QYNVLYRNINMVRSFVDACEAKKIMAFANIAQIDGAHNANATAREAWKVMPELMVQHALN
SIFSEKIGIDKSNICLSTVPPTAPPAPCLKIDLPYAVALRELFSDYKMRAQMNTKYMESS
TREATVTHVLNLLTSVLTRADIQSTITPDEGRNVPWHIYNIEACDTAKQALVGMDGLMDM
IELKDVGELRDKARELKERAVLYMEEISEVGGYFESVEQGFFVDSGNYPERNGDGISRKI
KGGVGEGTVYEREEDYLAPVTAHFGYNNVAQYDENAIDNPSMLIDGCTFENPDKIIYIDE
LDDFDNVENRLKESYEYRNGTKIKPEMEWCADGIVMITMMLPTDKRTAEFAALEFVKKMN
LQEIEVISREVMHESEGTRIEVKGRVPFDIDLNNLVIPEEPKVLTDEEIRADIEEKPMKI
VSATVGEDEHSVGLREIIDIKHGGIEKYGIECHYLGTSVPVEKLVDAAIELNADAILAST
IISHDDIHYKNMKKLHDYCVEKGIRDKVMIACGGTQVTPEIAVEQGIDAGFGRNSKGIHV
ATFLVEKRREMSNK
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgttaaaggaaaataaaaaattggatatagactatatattaaaagatttggataaatat
aaaccaaaacgaagaggttgggtttggagagaacacttggaaaatcttgaaatgggacct
tttaaatataaagactgtacaaaacctttaaagaagagtgtagggctaccatcatctaag
tatttcaataatatagaccctcaaccaagtccagttattactactgaaatagcttctggt
agatttgaggatgatataagaagaatgagaatggcagctcatcatggagctgaccatcta
atggttatcagaactgctggacaatcacattttgatgggcttatagaaggaactccacaa
ggtataggtggagttccaataacaagaaaacaagtaagagctcaaaggaaggctcttgat
tttatagaagaagaagttggtagacctattaattaccattcatatgtaagtggtgttgct
ggtcctgaagtagcagtaatgtttgctgaggaaggagtcaatggagcacatcaagaccca
caatataatgttctgtataggaatataaacatggtaaggtcttttgtagatgcttgtgag
gcaaagaaaataatggcttttgccaatatagctcaaattgatggagcacataatgctaat
gctactgctagagaagcatggaaggtaatgcctgaacttatggttcaacacgctttaaac
tctatattctcagaaaaaataggtatagataaaagtaatatatgcttatcaacagttcca
ccaacagcacctccagcaccatgtttaaaaatagacttaccttacgctgttgcacttaga
gagttatttagtgattataagatgagagctcaaatgaatactaaatatatggaatcatca
actagagaagcaacagttactcatgtattaaacttattaacatcagtattaactagagct
gacatacaatcaactataacacctgatgaaggtagaaatgtaccttggcatatatacaat
atagaagcatgtgatacagcaaagcaagctttagttggtatggatgggcttatggatatg
atagaacttaaagatgtcggtgaattaagagacaaagcaagagaacttaaagaaagagct
gtattatatatggaagaaatatctgaagttggtggatattttgaatctgtggaacaagga
ttttttgttgattctggaaattatccagaaagaaatggtgatggaatatctagaaaaata
aaaggtggagttggtgaaggtactgtttatgaaagagaagaagattatttagcacctgta
actgctcactttggatacaataatgtagctcaatatgatgaaaatgctatagataatcca
tcaatgttaatagatggatgtacatttgaaaatccagacaaaataatatatattgatgag
cttgacgattttgataatgtagaaaatagactaaaagaatcatatgagtacagaaatgga
actaaaattaagcctgaaatggaatggtgtgcagatggaattgtaatgataacaatgatg
cttcctactgataaaagaacagcagagtttgcagctttggaatttgtcaaaaaaatgaac
ttacaagaaattgaggtcataagtagagaagttatgcatgaatctgaagggactagaata
gaagtgaaaggaagagttccgtttgatatagatttaaacaatttagtaataccagaagaa
cctaaggtactaactgatgaagaaataagagcagatatagaagaaaaacctatgaaaata
gtttcagctacggttggagaagatgaacattcagttggtttaagagaaataatagatata
aaacatggaggtattgaaaaatatggcatagaatgccactatctagggacttctgtacct
gtagaaaaattggtagatgcagcgattgaactgaatgcagatgcaatacttgcatctaca
ataataagtcatgatgatattcactataaaaacatgaaaaaattacacgattattgtgta
gaaaaaggtataagagataaagtaatgattgcgtgtggaggaacacaagtaacacctgaa
atagctgttgaacaaggcatagatgctggatttggaagaaacagcaaaggcatacatgta
gccactttcttagttgaaaaaagaagagaaatgagtaataaataa

DBGET integrated database retrieval system