KEGG   Clostridioides difficile 630: CD630_10100Help
Entry
CD630_10100       CDS       T00487                                 

Gene name
nagA
Definition
(RefSeq) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00520  Amino sugar and nucleotide sugar metabolism
cdf01100  Metabolic pathways
cdf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CD630_10100 (nagA)
Enzymes [BR:cdf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     CD630_10100 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 4914485
NCBI-ProteinID: YP_001087491
UniProt: Q18AL1
Position
1177904..1179037
Genome map
AA seq 377 aa AA seqDB search
MKCLINGKIILKNQILENKVLVFDEKIIDIADSVPKDCEVIDADGKYISPGLIDIHIHGN
MGKDTMDSTDESIETISKSIMRHGVTSFLPTTMTMDKEHVYDALEVIKKAQNRKLEGAQV
LGAHLEGPFINENYKGAQNEKFIINSKYEFIKEYKDVIKVITYAPEKDIDFDFTREIKRC
TDIVLSIGHSNANYDQAKEAINLGVTNVTHMFNAMTGLNHRDPGVVGAALTTNVYSELIA
DTIHINKDLFQFILNNKGKERLILITDSIEAGGLEDGNYSLGGQKVIVKGNEARLENGAL
AGSVLSLNKMVFNFLDNTNLKVNEAINLASLNPATSLGINDKKGSLEIGKDADIAVFDEN
LDCKMTLCLGEVVYKNI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtttaattaatggaaagataatattaaaaaatcaaatcttagaaaataaagta
ttagtatttgatgaaaaaataattgatatagctgatagtgtaccaaaagattgtgaagtt
atagatgctgatggaaaatatatatctccagggcttattgatattcatatacatggaaac
atgggaaaagatacaatggattcgactgatgaatctattgaaacaatttcaaaatcaatt
atgagacatggagtaacatcttttcttccaactacaatgactatggataaagaacatgtt
tatgatgcacttgaagttattaaaaaagcccaaaatagaaagcttgaaggggcacaagta
ttaggagcacatttagaaggaccttttataaatgagaattataagggagcacaaaatgaa
aaatttataataaattcaaaatacgaatttataaaagaatataaagatgttataaaagtt
ataacttatgctccagaaaaagatattgattttgattttactagagaaataaaaagatgt
acagatatagttttatctattggtcatagtaatgcaaattatgaccaagctaaagaagct
ataaatttaggagtaactaatgtaactcacatgttcaatgcaatgactggtttaaaccat
agagacccaggcgttgttggtgcagcacttacaactaatgtgtacagtgagttaatagca
gatacaatccatataaataaagatttatttcaatttatactaaataataaaggaaaagaa
agactgattttaataacagattctatagaagctggtggtcttgaagatggcaattattct
cttggaggtcagaaagtcatagttaaggggaatgaagctagacttgaaaatggagcatta
gctggaagtgtgttgtctttaaataaaatggtatttaacttcttagataatacaaacctt
aaagtgaatgaagcaattaatttagcttctttaaatccagcaacatctttgggaataaat
gacaaaaaaggaagcttagaaataggtaaggatgcagatatagctgtatttgatgagaat
ttagattgtaaaatgacactttgcttgggggaagtagtatataaaaatatatag

DBGET integrated database retrieval system