KEGG   Clostridioides difficile 630: CD630_11910Help
Entry
CD630_11910       CDS       T00487                                 

Gene name
fbp
Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00010  Glycolysis / Gluconeogenesis
cdf00030  Pentose phosphate pathway
cdf00051  Fructose and mannose metabolism
cdf00680  Methane metabolism
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
cdf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_11910 (fbp)
   00030 Pentose phosphate pathway
    CD630_11910 (fbp)
   00051 Fructose and mannose metabolism
    CD630_11910 (fbp)
  Energy metabolism
   00680 Methane metabolism
    CD630_11910 (fbp)
Enzymes [BR:cdf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CD630_11910 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-GeneID: 4916186
NCBI-ProteinID: YP_001087684
UniProt: Q18B55
Position
1392082..1394067
Genome map
AA seq 661 aa AA seqDB search
MKNLCKISDDYLNSKLKYLKLLSKQYPSISKASTEIINLEAILNLPKGTEHFITDVHGEY
EPFVHVLKNGSGVIKRKIEELFSNTIRDSEKKMLATLVYYPEQKLDLIIKQEENIDDFYR
INIYRLIELCKYASSKYTRSKVRKLLPENFKYIIEELLHEHVKSEHKEEYYKSIVETIVD
IGIAKEFIIAISTVIQKLVVDRLHVIGDIYDRGPRPDIIVDKLIEHHCVDIQWGNHDILW
MGAASGEKTCIANALRISARYANLDIVEDIYGINLLPLATFAIEMYKDDPCKEFIPKVND
QSVTTTEKSLMAKMHKAISIIQFKLEGEVIRRRPEFEMEHRLLLNMINYDEGTINLKGKT
YKLKDTYLPTIDKKDPYKLTMEERNVIDKLVSSFRGSEKLQKHVSFLFSKGSIYLKANSN
LLIHGCVPLNEDGSFMSMNIMGKEYKGKALMDKMESLAREGFFFKDKAEEKLYGMDIMWY
LWTGKCSSLFGKDDMTTFERYFIAEKETHKENKNPYFKLRENEMACKRLFEEFDLELDES
HIINGHVPVESKNGESPIKANGKILVIDGGFSRAYQKTTGIAGYTLIYNSRTLQLVSHEP
FNSAEEAIANESDILSTTVVVEHKAKRKMVRDTDEGIKIQEEIEDLKLLLMAYKKGLIKE
M
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatctgtgtaaaatatcagatgattatttaaacagcaagcttaagtatttaaag
ttattatcaaaacaatatccaagtatatcaaaagcaagtacagaaataataaatttagag
gctatattaaatcttccaaagggaacagagcattttataacagatgtacatggtgaatat
gaaccatttgtacatgtattaaaaaatggttctggtgtaataaagagaaaaatagaagaa
ttgttttcaaatacaataagagacagcgaaaaaaaaatgttagcaactcttgtatattat
cctgaacaaaagttagacctaataattaagcaagaggaaaatatagatgatttttataga
ataaatatttatagacttatagaactttgtaaatatgcttctagcaaatatactaggtct
aaagttagaaaactgttaccagaaaattttaaatacataatagaagaacttttgcatgag
catgttaaaagtgaacataaagaagagtattataaaagtatagttgaaacaatagttgac
ataggaatagctaaggagtttataattgctatttctacagttatacaaaaattggttgta
gatagacttcatgtaataggagatatttatgatagaggtccaagaccagatataattgtc
gataagcttattgaacatcattgtgtagatattcaatggggaaatcatgatatattgtgg
atgggtgcagcctcaggtgaaaaaacttgtatagcaaatgcactgaggatatcagctaga
tatgcgaatttagacattgtagaagacatatatggaataaatctattgcctttagccact
tttgctatagaaatgtataaagatgacccttgtaaagaatttattccaaaggttaatgac
caaagtgtaacaacaacagaaaagtctttaatggcaaaaatgcacaaagcaataagtata
attcaatttaagcttgaaggtgaggttataagacgaagacctgaatttgaaatggaacat
agactcttgcttaatatgataaactatgatgaaggtacgattaatttaaaaggtaaaaca
tataaattaaaagatacttatttacctacaatagacaaaaaagacccatataaattaact
atggaagaaagaaatgttattgataaattagtatcttcatttagaggtagtgaaaaatta
caaaaacatgtttcatttttgttttctaaaggaagtatatatttaaaggctaactcaaat
ttactgattcatggatgtgtaccgttaaatgaagatggaagctttatgtctatgaatata
atgggaaaagagtataaaggtaaggctcttatggataagatggagtctctagcaagagaa
ggatttttctttaaagataaggcagaagaaaaactgtatggcatggatattatgtggtat
ttatggactgggaaatgttcatcattatttggtaaagatgatatgactacatttgaaaga
tactttatagctgaaaaagagactcataaagaaaataagaacccatattttaaacttaga
gaaaatgagatggcttgtaaaagattatttgaagaatttgatttagaacttgatgaatct
catataataaatggtcatgttcctgtggagagtaaaaatggagagagcccaataaaagct
aatggtaaaattctcgttatagatggtggtttttctagggcttaccaaaaaactactggt
atagctggatacactttgatatacaattctagaactttgcaattagtatcgcatgaacca
tttaattctgctgaagaagccattgcaaatgaaagtgatatcttatcgacaactgttgta
gtagagcataaggcaaagagaaaaatggtgagagatactgatgaaggaataaagatacaa
gaggaaatagaagatttaaaactacttttaatggcttataagaaagggctaataaaagaa
atgtag

DBGET integrated database retrieval system