KEGG   Clostridioides difficile 630: CD630_15480Help
Entry
CD630_15480       CDS       T00487                                 

Gene name
hisG
Definition
(RefSeq) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00340  Histidine metabolism
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01230  Biosynthesis of amino acids
Module
cdf_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CD630_15480 (hisG)
Enzymes [BR:cdf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     CD630_15480 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG
Motif
Other DBs
NCBI-GeneID: 4916284
NCBI-ProteinID: YP_001088049
UniProt: Q18C67
Position
1796765..1797391
Genome map
AA seq 208 aa AA seqDB search
MDYLTIALAKGRIEGESFKKFKKMGLGDSIDTDTRKLIFKDEENKIIYIHVKPSDVVTYV
EKGVADLGIAGKDTILENETDVYEIYDLGFGKCKFAVAGLKGDSIYREDEYLKVATKYPN
IAKKYFKEKGQKIEIIKLNGSVELAPIVGLSDVIVDIVETGNTLKANGLEILEDICNISA
RIISNRASYRFKYEQIQNIIRLFEELDN
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttggattatttgactatagcactagcaaaaggacgaattgaaggggaatcatttaaaaaa
tttaaaaaaatgggtctaggagatagtatagacacagatacgagaaaactaatttttaaa
gatgaagaaaataaaattatatatatacatgtaaagccatcagatgtagttacatatgtt
gaaaaaggagtcgctgacctcggtatagcaggtaaagatactattttagaaaatgagaca
gatgtatatgaaatatatgatttaggttttggaaaatgtaaatttgctgtagcaggatta
aagggagatagcatatatagagaagatgaatatttaaaagtggcaacaaagtatcccaat
atagcaaaaaagtattttaaagagaaaggtcaaaaaattgaaataataaaattaaatggt
tctgtagaactagctccaatagtagggttgtcagatgtaattgtagatatagttgagact
ggcaatacacttaaagcaaatggtcttgaaatattagaagacatatgtaatataagtgct
agaattatatcaaatagagctagctatagatttaaatatgaacaaattcagaatataatt
cgtttatttgaagaacttgataattaa

DBGET integrated database retrieval system