KEGG   Clostridioides difficile 630: CD630_22060Help
Entry
CD630_22060       CDS       T00487                                 

Gene name
aldH
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00010  Glycolysis / Gluconeogenesis
cdf00053  Ascorbate and aldarate metabolism
cdf00071  Fatty acid degradation
cdf00280  Valine, leucine and isoleucine degradation
cdf00310  Lysine degradation
cdf00330  Arginine and proline metabolism
cdf00340  Histidine metabolism
cdf00380  Tryptophan metabolism
cdf00410  beta-Alanine metabolism
cdf00561  Glycerolipid metabolism
cdf00620  Pyruvate metabolism
cdf00625  Chloroalkane and chloroalkene degradation
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_22060 (aldH)
   00053 Ascorbate and aldarate metabolism
    CD630_22060 (aldH)
   00620 Pyruvate metabolism
    CD630_22060 (aldH)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CD630_22060 (aldH)
   00561 Glycerolipid metabolism
    CD630_22060 (aldH)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD630_22060 (aldH)
   00310 Lysine degradation
    CD630_22060 (aldH)
   00330 Arginine and proline metabolism
    CD630_22060 (aldH)
   00340 Histidine metabolism
    CD630_22060 (aldH)
   00380 Tryptophan metabolism
    CD630_22060 (aldH)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CD630_22060 (aldH)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CD630_22060 (aldH)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CD630_22060 (aldH)
Enzymes [BR:cdf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CD630_22060 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC LD_cluster3
Motif
Other DBs
NCBI-GeneID: 4914541
NCBI-ProteinID: YP_001088720
UniProt: Q185Z3
Position
complement(2555601..2556965)
Genome map
AA seq 454 aa AA seqDB search
MDIKELVKMQRKYYNTGKTRDISFRIEQLKKLKLVVSQNEEKILLALKKDLNKSDFEGFM
TEVGMFYSELNFAIKNIRKWSKIKRVKSSMVNFPSISKVVPQPYGVTLIMSPWNYPFQLA
LIPLVWSLAAGNCVILKPSEYSASTSSVVKDIVEDTFSKEYVAVVQGSQEESEKLLLERF
DYIFFTGSTNVGKIIMKSASEHLTPITLELGGKSPCIILKDANIDLTAKRLTWGKLINAG
QTCVAPDYVLVHEDRKNELIEKIKYYTNKYFGDNPCNNEQFPKIINQKHFNRILSLIDKD
KIVYGGNYNKETLKIEPTIVDNVNWDDNIMKEEIFGPIFPILTYKDLDEVIQKIIQMPNP
LALYIFTKNKYLENKLLEMIPAGGCCINDTVTHIATNYLPFGGIGESGMGSYHGKAGFDT
FTHYKSVLKKLNLDVPIRYAPYDNKLIKVLKKIM
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggatataaaagagttagttaaaatgcaaagaaaatattataatacaggtaaaacaaga
gatatatcgtttcgtatagaacagttgaagaaacttaagttagttgtatcacaaaatgaa
gaaaaaatacttttagcactaaagaaagatttaaataaatcggattttgaaggttttatg
acagaagtaggcatgttttatagtgaattaaactttgctataaagaatataagaaaatgg
agcaaaataaaaagagttaaatcaagtatggttaattttccatctatatccaaagttgtt
ccacaaccttatggtgttactctcataatgtcaccttggaattatccatttcaattagca
cttataccattagtttggtcattagcagcagggaattgtgttatattaaaaccttctgaa
tattctgcgtcaacatctagtgtagttaaagacatagttgaagatactttttcaaaagaa
tatgttgcagttgttcaaggaagtcaagaagaaagtgaaaagttactattggaaagattt
gattatatattttttacagggagtactaatgttggtaaaataatcatgaaatcagcatca
gagcatttaactcctattactttagaacttggaggaaaaagtccttgtatcattttaaaa
gatgctaatatagaccttactgccaaaagacttacttggggaaaactaataaatgcagga
caaacctgcgtggctccagattatgttttagtgcatgaagatagaaaaaatgagttaata
gagaaaataaaatattatactaataagtattttggagataatccatgtaataatgagcaa
tttcctaaaatcataaatcagaaacattttaatcggatattatctcttattgataaagat
aagatagtctatggtggaaattataataaggagacattaaagatagagccaactatagta
gacaatgttaattgggatgataatataatgaaggaagaaatatttgggcctatatttccc
attttaacatataaagatttggatgaagtaatacaaaaaattatacaaatgccaaatcca
ttggcactttatatttttacaaaaaataagtacctagaaaataaacttttagaaatgatt
ccagcaggaggatgttgtatcaatgatacagttactcatatagctacaaattacttacct
tttggtggtattggtgaaagtggtatgggctcatatcatggaaaagctggattcgataca
tttactcattataagagtgtgttaaaaaaattaaatttggatgtccctattagatatgct
ccatacgataataaattaattaaggttcttaaaaagataatgtag

DBGET integrated database retrieval system