KEGG   Clostridioides difficile 630: CD630_22770Help
Entry
CD630_22770       CDS       T00487                                 

Definition
(RefSeq) class II aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00051  Fructose and mannose metabolism
cdf01100  Metabolic pathways
cdf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CD630_22770
Enzymes [BR:cdf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CD630_22770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 4916417
NCBI-ProteinID: YP_001088789
UniProt: Q185E8
Position
complement(2642323..2642970)
Genome map
AA seq 215 aa AA seqDB search
MLDSLKGKVVEIAIKAEHYGLCKEKTGNFSIRDKDTGYILITPSGIGREELKVEHICVLD
LDGNVIEVEKGIKPSSEVLMHIEIYKTRENINAISHTHSLYATAFSVAKKPIIPIVYESV
NYGGYVDIASYERPGTLKLAKSVSKLLIDTDACLLERHGLTTVGNDLDEALLKSRYVEEV
AEIYYRSLVLNQFKELEVVDVDEFKSWKYPEEIKF
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgctagactctttaaaaggtaaagttgtggaaatagcaattaaagcagagcattatggt
ttatgtaaagaaaagactggtaattttagtattagagataaggatactggatatatactt
ataaccccatcaggtataggaagagaagaattaaaagttgaacatatttgtgtattggat
ttggatggaaatgtaatagaagttgagaaaggtattaagccaagtagtgaggtattgatg
catattgaaatatacaaaacaagagaaaatataaatgccatatcacatactcattcttta
tatgcaacagcattttcagtagcaaagaaaccaattataccaattgtatatgaatcagtt
aattatggcggttatgtagatattgcttcatacgaaagaccaggaactttaaaattagct
aagagtgtttcaaaattactgatagatacagatgcatgcttattagaaagacatgggttg
acaactgtaggtaatgatttagacgaagcattattaaaatcaagatatgttgaagaggta
gcagaaatatactataggtctttagtattaaatcaatttaaagaacttgaagtagtagat
gttgatgagtttaaatcttggaaatacccagaagaaataaagttttaa

DBGET integrated database retrieval system