KEGG   Clostridioides difficile 630: CD630_25910Help
Entry
CD630_25910       CDS       T00487                                 

Gene name
ltaE
Definition
(RefSeq) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00260  Glycine, serine and threonine metabolism
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
cdf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CD630_25910 (ltaE)
Enzymes [BR:cdf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CD630_25910 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Pyridoxal_deC Aminotran_5 Cys_Met_Meta_PP Coq4
Motif
Other DBs
NCBI-GeneID: 4914757
NCBI-ProteinID: YP_001089108
UniProt: Q182T0
Position
complement(2996822..2997856)
Genome map
AA seq 344 aa AA seqDB search
MRFIDLRSDTVTMPTDEMREAMAKAPVGDSIFRDDPTVNKLEELAAAKVGKEDAIFLPSG
TFGNQLALFTHCLRGQEIIIGKGYHIVTHEVGAPAVIAGVQLRTIDEDESGALNPELVEK
AIRRDDIHEPQTGLICVENAYSGGTVVSLDNLREIKKIAEKHNLPVHLDGARLFNAALTL
GVEAKEIAKCCDSVMFCVSKGLAAPMGSILAGSKEFIAKARRKQKVMGGGMRQVGIVAAA
GIIAIEKMTLRLNEDHENAKYLACELNKIDGIEVNNVNPDISMVFFKMSEDIIKEDVLIK
EFFERNIKINKMENGEYRFVTHVDITKEDLDYVLKTLKELIGVS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagatttatcgatttaagaagtgatactgttactatgcctactgacgaaatgagagaa
gctatggcaaaggctcctgttggagattcaatctttagagatgaccctactgtaaataaa
cttgaagaattagcagcagctaaagttggaaaagaagatgctattttccttccaagtgga
acttttgggaatcaattagctctatttactcattgcctaagagggcaagaaataattatt
ggtaaaggttatcacattgtgactcatgaggttggggcacctgctgtaatagctggagtt
cagcttagaactatagatgaagacgaaagtggagctctaaatcctgaacttgttgaaaag
gcaattagaagagatgacatacatgaaccacagacagggcttatatgtgtagaaaatgca
tattcaggtggaacagttgtgagtcttgataatttaagagaaattaaaaaaatagctgag
aaacataacttaccagtacatttagatggagcaagattatttaacgcagcattaactttg
ggtgtagaagctaaagaaatagcaaagtgttgtgatagtgttatgttctgtgtgtcaaaa
ggtttagctgcaccaatgggttctatacttgctggaagtaaagaatttatagcaaaagct
agaagaaagcaaaaagttatgggtgggggaatgagacaagtaggtatagttgcagcagct
ggtataattgccattgaaaaaatgactttaagattgaatgaagaccatgaaaatgcaaaa
tatttagcttgtgaattaaataaaattgatggcattgaagtaaataatgttaatccagat
ataagtatggtattttttaagatgagtgaagatattataaaagaggatgttttaataaaa
gaattttttgaaagaaatataaaaattaataaaatggaaaatggtgaatatagatttgta
actcatgtagatattactaaggaagatttagactatgttttaaaaacacttaaagaatta
ataggtgtatcttaa

DBGET integrated database retrieval system