KEGG   Clostridioides difficile 630: CD630_26760Help
Entry
CD630_26760       CDS       T00487                                 

Gene name
thlA2
Definition
(RefSeq) acetoacetyl-CoA thiolase 2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00071  Fatty acid degradation
cdf00072  Synthesis and degradation of ketone bodies
cdf00280  Valine, leucine and isoleucine degradation
cdf00310  Lysine degradation
cdf00362  Benzoate degradation
cdf00380  Tryptophan metabolism
cdf00620  Pyruvate metabolism
cdf00630  Glyoxylate and dicarboxylate metabolism
cdf00640  Propanoate metabolism
cdf00650  Butanoate metabolism
cdf00900  Terpenoid backbone biosynthesis
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
cdf01200  Carbon metabolism
cdf01212  Fatty acid metabolism
cdf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CD630_26760 (thlA2)
   00630 Glyoxylate and dicarboxylate metabolism
    CD630_26760 (thlA2)
   00640 Propanoate metabolism
    CD630_26760 (thlA2)
   00650 Butanoate metabolism
    CD630_26760 (thlA2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CD630_26760 (thlA2)
   00072 Synthesis and degradation of ketone bodies
    CD630_26760 (thlA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CD630_26760 (thlA2)
   00310 Lysine degradation
    CD630_26760 (thlA2)
   00380 Tryptophan metabolism
    CD630_26760 (thlA2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CD630_26760 (thlA2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CD630_26760 (thlA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CD630_26760 (thlA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cdf04147]
    CD630_26760 (thlA2)
Enzymes [BR:cdf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CD630_26760 (thlA2)
Exosome [BR:cdf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CD630_26760 (thlA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-GeneID: 4914399
NCBI-ProteinID: YP_001089187
UniProt: Q183B0
Structure
PDB: 

Position
3092064..3093242
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVSAVRTPIGSFGGVFKNTSAVQLGTIAVKEAISRVGLNLSEIDEVIIGNVLQTG
LGQNVARQIAINAGIPNSVPSYTVNKLCGSGLKSVQLAAQSITSGENDVVIAGGTENMSQ
APYIVPTARFGSKMGNITMVDSMLTDGLIDAFNQYHMGITAENIATKFEFTREMQDKLAL
ESQNKAENAIKNNRFKEEIVPVDVLIRRGKIETIDKDEYPKLGMTFEGLSKLKPAFKKDG
TVTAGNASGINDGAAMLILMSQQKADELGIRPLAKIKSYASAGVEPEVMGTGPIPATRKA
LKKAGLSINDIDLIEANEAFAAQALAVKNELQIDSSKLNVNGGAIALGHPIGASGARILV
TLIYEMQKRKVETGLATLCIGGGQGISMVVSR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtagtaatcgtatcagcagtcagaacacctataggaagttttggaggtgta
tttaaaaatacttcagctgttcaacttggaactatcgctgttaaagaagcgatatcacgt
gtaggacttaatttatctgaaatagatgaagtaataattggaaatgttcttcaaacaggg
cttggacagaatgttgctagacaaattgctataaatgcaggtataccaaattctgttcca
agctacacagtaaataaattatgtggttcagggcttaaaagtgtccagctagctgcccaa
tcaatcacatctggtgaaaatgatgtggtaattgcaggtggtactgaaaatatgagtcaa
gctccttatatcgttccaactgctcgctttggtagtaaaatgggtaacataaccatggta
gatagtatgctaacagatggccttattgatgctttcaatcagtatcatatgggaataact
gcagaaaatattgcaactaaatttgaatttactagagaaatgcaagataaattggcatta
gaaagtcaaaataaggctgagaatgctataaaaaacaaccgctttaaagaagaaatcgtt
ccagtagatgttttaatacgtcgaggaaaaatagaaactattgataaagatgaatatcct
aaattaggtatgacatttgaaggtttatctaaacttaaacctgcattcaaaaaagatggt
actgtaacagctggaaatgcctcaggtattaatgatggtgcggctatgttaatactaatg
agccaacaaaaagcagacgaactaggtattagaccacttgctaaaataaaatcctatgct
tcagctggtgttgaacctgaagtcatgggtactggtccaatccctgcaactagaaaagca
ctgaaaaaagctggacttagcatcaatgatatagacttaatagaagcaaatgaagcgttt
gctgcccaagcattagctgttaaaaatgaacttcaaatagattcatcaaagttaaatgtt
aatggtggtgcaatagcattaggacatccaataggagcaagtggagctagaatacttgtt
accttaatttatgaaatgcaaaaacgtaaagttgaaactggacttgcaacactttgtatt
ggtggtggtcaaggaatatcaatggtggtttcacgatag

DBGET integrated database retrieval system