KEGG   Clostridioides difficile 630: CD630_27150Help
Entry
CD630_27150       CDS       T00487                                 

Gene name
gtaB
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00040  Pentose and glucuronate interconversions
cdf00052  Galactose metabolism
cdf00500  Starch and sucrose metabolism
cdf00520  Amino sugar and nucleotide sugar metabolism
cdf01100  Metabolic pathways
cdf01130  Biosynthesis of antibiotics
Module
cdf_M00362  Nucleotide sugar biosynthesis, prokaryotes
cdf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CD630_27150 (gtaB)
   00052 Galactose metabolism
    CD630_27150 (gtaB)
   00500 Starch and sucrose metabolism
    CD630_27150 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    CD630_27150 (gtaB)
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CD630_27150 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 4916722
NCBI-ProteinID: YP_001089226
UniProt: Q183E9
Position
complement(3141599..3142474)
Genome map
AA seq 291 aa AA seqDB search
MQMTVKKAIIPAAGLGTRFLPATKSQPKEMLPIVDKPTLQYIIEEAIESGIEEILIITGR
NKKSIEDHFDKSVELELELEQKGKTEMLEMVRDISNMVNIHYIRQKEPKGLGHAIYCAKS
FIGDEPFAVLLGDDIVDSDVPCLKQLIDTYNEYKTTVLGVQKIAKEDTNKYGILDVKHIE
DRVYKVKDMVEKPAIEEAPSDIAILGRYIITPAIFSILEKQTPGKGGEIQLTDALQTLGK
QEAIYAYNFEGRRYDVGDKIGFLEATIDFALKRENLKDDLMDYMRKKVSEK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagatgacagttaaaaaagcaataataccagcagcagggctaggaactagattttta
ccagcaacaaaatcacagcccaaagaaatgcttcctatagtagataaaccaactttacag
tatataatagaagaagctatagaatcgggaattgaagaaattcttataataacaggtaga
aataaaaaatctatagaagatcattttgataaatcagttgaattagagttagaactagag
caaaaaggtaagacagagatgttagaaatggtaagagacatatcaaatatggtaaatatt
cattatataagacaaaaagagccaaaaggtcttggacatgcaatttactgtgcaaaaagt
tttataggtgatgaaccttttgccgtattattaggtgatgatatagtagattcagatgtt
ccgtgcttaaaacaattaatagatacttataatgagtataaaacaactgtattaggtgtt
caaaagatagctaaagaagatactaataaatatggtatattggatgtaaaacatatcgaa
gatagagtatataaagttaaagatatggttgaaaaacctgcaattgaagaagctccatct
gatatagctatacttggaagatatataataactcctgcaatatttagcatattagagaaa
cagacacctggtaaaggtggagagatacaactgacagatgcacttcaaactcttggaaaa
caagaggctatttatgcttataactttgaaggtagaagatatgatgtgggagataagatt
ggttttttagaggcaacaatagactttgctctaaagagagaaaatttaaaagatgattta
atggactatatgagaaaaaaagtaagtgaaaaataa

DBGET integrated database retrieval system