KEGG   Clostridioides difficile 630: CD630_31100Help
Entry
CD630_31100       CDS       T00487                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00010  Glycolysis / Gluconeogenesis
cdf00030  Pentose phosphate pathway
cdf00051  Fructose and mannose metabolism
cdf00052  Galactose metabolism
cdf00680  Methane metabolism
cdf01100  Metabolic pathways
cdf01110  Biosynthesis of secondary metabolites
cdf01120  Microbial metabolism in diverse environments
cdf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cdf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CD630_31100
   00030 Pentose phosphate pathway
    CD630_31100
   00051 Fructose and mannose metabolism
    CD630_31100
   00052 Galactose metabolism
    CD630_31100
  Energy metabolism
   00680 Methane metabolism
    CD630_31100
Enzymes [BR:cdf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CD630_31100
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CD630_31100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 4916653
NCBI-ProteinID: YP_001089624
UniProt: Q184U6
Position
3618638..3619852
Genome map
AA seq 404 aa AA seqDB search
MRNCIIAQSGGPTAVINASAVGIYEKNLETKYFDKVYFGINGIEGILNKNIIDSDSLNKD
NVLNLKQTPSSGLGSCRYKLADYKINSYDYDRVINILDEYEIDTLFYIGGNDSMDTVMKF
SQYCKNTTCKIKFIGIPKTIDNDLLGTDNCPGFGSAAKLISTLIMETYLDFSIYKNNGIF
IVETMGRDTGWLAASSSLARLNDTPLVDLIYLPEIDFYEDKFIEDVRKIFKEKNKAYIVA
SEGIRDKYGNFICEQKTSAHDKFGHSQLGGVSNYLKNLIVSSSITTRVKTLELGVIQRCA
MHLASDTDLKQAAEVGAYGIELSKKGYTGVMAIINRTCNNPYKYEVSHTDISKIANKTKY
FPKEWINEECNYITDEALNYLYPLIQGKPDIKYKNGLPYFSIIY
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaactgtattattgcccaatctggaggccctacagctgttatcaatgcttctgca
gttggtatttatgaaaaaaatttagaaactaaatactttgataaagtatattttggtatc
aatgggattgaaggtatattaaacaaaaatataatagattcagactccttaaacaaagat
aatgtattaaatttaaagcaaacaccttcgtctggtcttggttcttgtagatacaaactg
gctgattataaaataaattcttatgattatgatagagttataaatatactagatgaatat
gaaatagatacattattttatataggcggaaatgattctatggacacagtgatgaaattt
tctcaatactgcaaaaacactacttgtaaaataaaatttataggtattcctaaaacaata
gataatgatttattaggaactgacaactgtcctggatttggttctgctgcaaagcttatt
tctacactaataatggaaacatacttagatttttctatatacaaaaataatggtatattt
atagtagaaactatgggtagagatactggatggttagcagcttcttcttcactagctaga
cttaatgatactccacttgttgatttaatataccttccagaaattgatttctatgaagat
aagtttatagaagatgttagaaaaatatttaaagaaaaaaataaggcttatatagttgca
tcagaaggtataagggataaatacggcaactttatatgcgaacaaaaaacttctgctcat
gataaatttggtcattcccaattaggtggagtaagcaactatctaaagaatcttatagta
tcatcatcaattacaacaagagtaaaaaccttagaacttggtgtaatacaaagatgtgct
atgcatttagcttcagatactgatttaaaacaagcagctgaagttggtgcatatgggata
gaactatctaaaaaaggatatacaggagttatggctatcattaatagaacatgcaataat
ccttataagtatgaagttagtcatactgatatttctaaaatagctaacaagacaaaatat
tttcctaaagagtggataaatgaagaatgtaattatataactgatgaagccctaaattat
ctatatccacttattcaaggtaaaccagatatcaaatataaaaatggactaccttatttt
tcaattatttactag

DBGET integrated database retrieval system