KEGG   Clostridioides difficile 630: CD630_36550Help
Entry
CD630_36550       CDS       T00487                                 

Gene name
purA
Definition
(RefSeq) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
cdf  Clostridioides difficile 630
Pathway
cdf00230  Purine metabolism
cdf00250  Alanine, aspartate and glutamate metabolism
cdf01100  Metabolic pathways
Module
cdf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:cdf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CD630_36550 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CD630_36550 (purA)
Enzymes [BR:cdf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CD630_36550 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt DUF1033
Motif
Other DBs
NCBI-GeneID: 4915544
NCBI-ProteinID: YP_001090179
UniProt: Q181Q7
Position
complement(4266203..4267492)
Genome map
AA seq 429 aa AA seqDB search
MKTVAIVGSQWGDEGKGKVIDYLATQADVVVRGQGGNNAGHTLVVEGKKYALHLIPSGVL
NPNTVNIIGNGIVFDPKGFLEELEMFKTDNISTENIKISDRAHVIFPYHKELDALSEEAR
GDLKIGTTKKGIGPCYMDKTERSGIRICDLMDKDKFAIKLKAQIDAKNEIVKNIYGKEEL
FDFETIYNEYLGYAEQIRKYVADTSVIVYDAVRAGKKVLFEGAQGTLLDLDLGTYPFVTS
SHPTSGGFAIGAGIGPNMIKDVVGIVKAYTTRVGEGPFVTEQINETGDKIREQGHEFGVT
TGRPRRCGWFDAVIVKYAARVNGLTSISFMLLDVLTGFDKIKVCTSYKMGDKIITDFPAS
LDDLAKCEPVYEELDGWNEDITQIDNFDDLPENAKKYVAKIEELVGVSVDMVSVGPNRAQ
TIIRRNIFA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgcaattgttggttctcaatggggagatgaaggtaaaggtaaagttata
gattatcttgctactcaagcagatgtagtagtaagagggcaaggtggaaataatgcagga
catacattagttgtagaaggtaaaaaatatgcattacatctaattccatctggagtttta
aatccaaatacagtgaatataatcggaaatggaatagtgtttgaccctaaaggattttta
gaagaattggaaatgtttaaaacggataatataagtacagaaaatataaaaataagtgat
agagcacatgtcatattcccatatcataaagaactagatgcattgtcagaagaagccaga
ggcgatttaaagataggtacaacaaaaaaaggtattggaccttgttatatggataaaaca
gagagatctggtattagaatatgtgacttaatggataaagataaatttgctataaaatta
aaagctcaaatagatgctaaaaatgaaatagttaaaaatatatatggaaaagaagaacta
tttgattttgaaactatatataacgaatatctaggatatgcagaacaaataagaaaatat
gtggcagatacgtctgttattgtatatgatgcagtaagagcaggtaaaaaagtattgttt
gaaggagcacaagggactttattagatttagatttaggaacttatccatttgttacatct
tctcatccaacatctggtggatttgcaattggtgcaggtataggaccaaatatgataaaa
gacgttgttggtatagtaaaagcatatactacaagagttggagaaggaccgtttgttaca
gagcaaataaatgaaactggagataagataagagaacaaggacatgaatttggggtaact
actggtagaccaagaagatgtgggtggtttgatgcagttatagttaagtatgcagctaga
gttaatggattgactagtatttcatttatgttacttgatgtattaactggatttgataag
ataaaagtttgtacgtcttataaaatgggcgataagataataacggatttcccagcttca
ttagatgatttagcaaaatgtgaacctgtatatgaagaattagatggatggaatgaagat
ataactcaaatagataactttgatgaccttccagagaatgcaaagaaatatgtagcaaaa
atagaagaactagttggagtaagtgtagatatggtttctgttggtccaaatagagctcaa
actataataagaagaaatatatttgcttaa

DBGET integrated database retrieval system