KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0027Help
Entry
CDB402_0027       CDS       T01688                                 

Gene name
thiC
Definition
(GenBank) thiamine biosynthesis protein ThiC
  KO
K03147  phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00730  Thiamine metabolism
cdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CDB402_0027 (thiC)
Enzymes [BR:cdh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     CDB402_0027 (thiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiC_Rad_SAM ThiC-associated Nuc_recep-AF1
Motif
Other DBs
NCBI-ProteinID: AEX45339
Position
28840..30639
Genome map
AA seq 599 aa AA seqDB search
MSAASANSATNPSAWENSEIHPKHSYSPIVSGDLEVPETEIQLDDSPTGPNDPVRIYRTR
GPECDPTVGLKPLRAQWIDSREDTEEYAGRERNLADDGRSAQRRGAASLEWKGVKPTPRR
AKQGKRVTQMHYARQGIITKEMEFVALREHMDPEFVRSEIARGRAIIPNNINHPESEPMI
IGRKFLTKINANIGNSAVTSSIEEEVSKLRWATRWGADTVMDLSTGDDIHTTREWIIRNS
PVPIGTVPIYQALEKVNGVAEDLTWEIFRDTVIEQCEQGVDYMTIHAGVLLAYIPLTTKR
VTGIVSRGGSIMAGWCLAHHKESFLYEHFDELCEIFAQYDVAFSLGDGLRPGSVADANDA
AQFAELKTIGELARRAWEYDVQVMIEGPGHVPLNMVQENNELEQKWAHDAPFYTLGPLVT
DIAPGYDHITSAIGAAHIAMGGTAMLCYVTPKEHLGLPNRDDVKTGVITYKLAAHAADVA
KGHPGARAWDDAMSKARFEFRWHDQFALSLDPDTAIAYHDETLPAEPAKTAHFCSMCGPK
FCSMRISQDIRDMFADKITDLGIPQVGGDAEAGMAAKSEEFVAQGSQLYSEVRDNAAHA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggcagcctcagctaattcagcaaccaatccatctgcttgggaaaactccgagatc
catccgaagcactcgtattcgccgatcgtttccggtgaccttgaggtcccagaaacggag
attcagcttgacgattctcctactggccccaatgatccagttcggatctatcgcacccgt
ggccctgagtgtgatcccacggtgggattgaagccactgcgcgcacagtggattgatagc
cgtgaggacacggaagaatatgctggccgtgagcggaatttggctgatgatggccgctcc
gcgcagcgtcgtggcgcagcgtcgctggagtggaaaggtgtgaaacccacaccgcgacgc
gccaagcagggcaagcgcgtgactcagatgcactatgcacgccagggcattattacgaag
gaaatggagttcgtggcgctgcgcgagcacatggacccagagtttgtgcgcagcgagatc
gcccgtggccgtgcgatcattccgaacaacattaaccacccagaatcggagcccatgatt
attggtcgaaagtttttgaccaagatcaacgccaatatcggtaactccgcagtaacctcc
agtattgaggaagaagtatccaagctgcggtgggctacccgctggggtgcagataccgtg
atggatttgtccaccggcgatgatattcacaccacccgcgaatggattatccgcaactcc
ccagtaccaatcggtacggtgccgatctatcaagcgctggaaaaagtcaatggtgtagca
gaagaccttacgtgggagattttccgcgataccgtcattgagcagtgtgaacaaggtgtg
gactacatgaccattcatgccggtgtgttgctcgcctacattccactgaccaccaaacgc
gtaaccggaattgtatcccgtggtggatccatcatggctggttggtgccttgcacaccat
aaggagtccttcctttacgagcactttgatgagctgtgcgagattttcgcgcagtacgac
gtcgccttctcgttgggtgatggcctgcgccctggttctgttgccgatgcgaatgatgcg
gcccagttcgcggagctgaaaaccattggtgagctggctcgtcgtgcgtgggaatacgat
gtgcaggtcatgatcgagggcccaggtcacgttccgctgaacatggtgcaggaaaacaat
gagctggagcaaaagtgggctcacgatgcgcctttctacactcttggcccattggtgacc
gatattgcgccaggctatgaccacatcacctcggcaattggagctgctcatatcgctatg
ggtggtacggcgatgctgtgttatgtgaccccgaaggagcacttgggtctgcccaaccgt
gatgatgtaaaaaccggtgtgattacttataaactcgcagctcatgcggccgatgtggct
aaggggcaccctggtgctcgtgcgtgggatgatgcgatgagcaaggcgcgttttgagttc
cgttggcatgatcagttcgcgttgtcgcttgatccagataccgcgattgcttaccatgac
gaaacgcttccggcggaaccggcaaagactgcgcacttctgttccatgtgtggtccgaag
ttctgctccatgcgcattagccaagatattcgtgacatgttcgcagataagatcaccgac
ttgggtatcccgcaggttggcggcgacgcagaagctggtatggcggcaaagtctgaggag
tttgtggcccaaggatcgcagctttatagcgaggtgcgtgacaatgctgcccacgcctag

DBGET integrated database retrieval system