KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0040Help
Entry
CDB402_0040       CDS       T01688                                 

Gene name
cas18
Definition
(GenBank) CRISPR-associated protein
  KO
K15342  CRISP-associated protein Cas1
Organism
cdh  Corynebacterium diphtheriae INCA 402
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cdh03400]
    CDB402_0040 (cas18)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:cdh02048]
    CDB402_0040 (cas18)
DNA repair and recombination proteins [BR:cdh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factor
     CDB402_0040 (cas18)
Prokaryotic defense system [BR:cdh02048]
 CRISPR-Cas system
  Universal Cas proteins
   CDB402_0040 (cas18)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cas_Cas1 GSH_synthase
Motif
Other DBs
NCBI-ProteinID: AEX45352
Position
45324..46259
Genome map
AA seq 311 aa AA seqDB search
MSATPSQSPLDRLLLPRMESRLSFLYVERAVINRDGNALTIKDQRGIAHVPATQLAVVLL
GPGTKVTYAAMALLGDAGASVVWVGEKGVRYYAHGRPPAKTSRFAEAHARLWSNQRSRLR
GARRMYDMRFPGEEISQLSLAQLRGREGARMKKIYAAEAQRTGVVWTRRNYDPQDFESGD
PINRALTEGSAALYGIAHAVIVGLGFIPSLGIVHTGTDRAFVYDIADLYKAEISIPAAFE
AVAAIPSGDDLNVRARIRDKVVSTRLMQRMVHDLQDLMEIPEEDTYSDVDLMLWSELEVI
AAGVNWSTERF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccacccctagtcagagcccattagatcgcttgctacttccacgaatggaaagt
cgattgtcattcctttatgtggaaagagccgtgatcaatcgtgatgggaatgcactgacg
attaaagatcagcgcggaatcgctcatgtcccagcaactcaactagcagttgttttgctg
gggcctggcaccaaagtgacgtatgcggcgatggcattgcttggcgacgccggcgcttcc
gtcgtctgggtaggggagaagggggtgcgctattacgcacatggtcgaccacctgccaaa
acttctcgttttgcagaagctcacgctcgactatggagtaatcagcgcagtcgccttcgg
ggcgcacgacgcatgtatgacatgcgcttcccaggagaggaaatctcgcagctatctctg
gcacaacttcgcggcagagaaggcgccagaatgaagaaaatctatgccgcagaagcacaa
cgcacaggtgtggtgtggacacgtagaaactatgatcctcaagattttgaatcaggtgat
cccattaatcgtgcgcttaccgaaggatcggctgctttatatggcattgcccacgcggtg
atcgtaggtcttggttttatcccttctctcgggatcgtacataccggtactgaccgtgcg
tttgtctatgacattgcagatctttataaggcagaaatctccattcctgctgcttttgaa
gccgtagcagctattccctcgggcgacgatctcaatgtgcgtgcacggattcgtgacaag
gttgtgagcacccgattgatgcagcggatggttcatgatcttcaagatctcatggagatc
ccagaagaagatacctattccgatgttgatctcatgctgtggagtgaactcgaggtcatt
gctgctggtgtgaactggtcaacagagagattttga

DBGET integrated database retrieval system