KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0045Help
Entry
CDB402_0045       CDS       T01688                                 

Gene name
pbp2A
Definition
(GenBank) putative secreted penicillin-binding protein 2
  KO
K05364  penicillin-binding protein A
Organism
cdh  Corynebacterium diphtheriae INCA 402
Pathway
cdh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cdh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDB402_0045 (pbp2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cdh01011]
    CDB402_0045 (pbp2A)
Peptidoglycan biosynthesis and degradation proteins [BR:cdh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   CDB402_0045 (pbp2A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AEX45357
Position
complement(50548..52008)
Genome map
AA seq 486 aa AA seqDB search
MNRSIRFTSVFALLLILILLVNLTIIQGFSQEKYAHNALNRRGFIELKSQARGQISTGGQ
VLAESYQDEEGFYQRRYVTNPAIYGPIEGYLSDIYGASGMESNLNGVLSGTDSSVSVRRW
TDELLGRKHSGANVELTLLPQVQEVAYNQMANAGYEGAVVAIKPSTGEILAMASTPSYDP
SAIVNPDTAEQTWAALNADPGNPLLNHATQETLPPGSTFKVITTAAGLNAGYGPGSMLTG
QDRITLPDGITTLENYAGQTCAGSQNVTLATAFQYSCNTAFVQMGIDVGKEKFDEAAHAF
GVNDRYDLGVDMAPGTIGDVSDPSARGQSSIGQRDVAMSVLHNAVVAATVANGGKRMEPH
LVSRIVGQDLKVIKETKPHQINEAVTPEVAATLTDLMRLSERHTAGYTGADIASKTGTAE
HGEDSRNSNPHAWYIAFGPSANADVAVAVVVKNGGDAGQAATGGSVAAPIGRAVIAAAQA
ALAARG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgatctatccgattcaccagcgtgttcgcgctgctgctgatcctgattttgttg
gtcaacttgacgatcattcagggttttagtcaggaaaaatacgcgcataatgcgcttaat
cgacgcggctttattgagttgaagtcgcaggcccgcggccagatctccactggtgggcag
gtactagccgagtcctaccaggatgaggaggggttctaccagcgtcgttacgtgaccaac
cctgcgatctatggtccgatcgaaggctacctgtctgacatttatggggcttcgggcatg
gaatccaacctcaacggtgtgctcagcggcacggattcttccgtttcggtgcgccgctgg
acagatgagcttttgggccgcaaacacagcggagccaacgttgagctcaccttgctgcca
caggtgcaagaggtggcatacaaccagatggccaatgctggctatgagggcgcagttgtg
gcgatcaagccgtcgacaggcgaaatccttgctatggcatcaacccctagctacgacccc
tcggcgatcgtcaaccccgataccgctgagcaaacatgggctgcgttgaacgccgacccc
ggcaacccgctgctcaaccacgccactcaagagacgctgccaccaggttctaccttcaag
gtgattaccacagcggctggccttaacgctggttacggcccgggctcgatgctcacgggg
caagaccgcattacgcttcccgacggcatcaccaccttggaaaactatgcgggacaaacc
tgtgccggttcccaaaatgtcaccttggctaccgcattccagtactcgtgcaacaccgca
ttcgtgcagatgggtattgatgttggcaaagaaaagttcgatgaggccgcccatgctttc
ggcgtgaatgatcgctacgatcttggcgtcgacatggcccctggcaccatcggtgacgtg
tcggatccgtcggcacgcgggcagtcgtcgatcggccagcgcgacgttgccatgtccgtg
ctccacaacgccgtcgtggccgccaccgtggccaatggtggcaagcgcatggagccgcac
cttgtgagccggatcgtcggccaagacctcaaggtgattaaggagactaagccgcaccag
atcaacgaggccgttacccccgaggtagccgccacgttgacggacctaatgcgactatcg
gaacgccacacggctggttataccggtgccgacattgcctccaagaccggtaccgccgag
cacggtgaggattcccgtaactccaacccgcacgcctggtacatcgcgttcggcccttcc
gccaatgccgacgttgccgtggccgtggtggtgaaaaacggtggcgatgccggtcaagcc
gccaccggtggttccgtggccgcgcccattggccgcgccgtcatcgcagcagcacaagca
gccctagcagcacgaggatag

DBGET integrated database retrieval system