KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0057Help
Entry
CDB402_0057       CDS       T01688                                 

Definition
(GenBank) two-component system response regulator
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_24 HTH_23 Sigma70_r4 Sigma70_ECF RTP1_C1 HTH_40 HTH_20 HTH_29 HTH_10
Motif
Other DBs
NCBI-ProteinID: AEX45369
Position
complement(61371..62030)
Genome map
AA seq 219 aa AA seqDB search
MIRIVLADDQPPILKAFSTIIHSRDTMRVVATAANGAEAINACMSHNVDVVVMDIRMPVM
DGITAARAILSRHPRIHIVMLTTFDDPTLVREALTAGVHGFLLKDADPEIFLTAIEAIHS
GESVLASGVTKQVIDTFRHAYGSNLSPEQRQGLSLITRREMDVLLRVAQGLTNAEISADL
GIAETTVKTHITALLAKVHARDRVALVLFAHKAGLLLPR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcattgtgcttgccgacgaccaaccgcccatcctcaaagcgttctccacaatc
atccactcccgcgacaccatgcgcgtagtggccacagccgccaacggcgccgaagccatc
aatgcgtgcatgagccacaacgtggatgttgtggtcatggatatccgcatgcccgtcatg
gatggcatcaccgcagcacgcgccatcctctcccggcaccctcgcatccatatcgtcatg
ctcaccactttcgacgaccccacgctcgtccgcgaagcgctgaccgccggagtgcacgga
tttcttcttaaagacgccgaccccgaaatcttcctcaccgcaatcgaggcgatccactca
ggggaatccgttctagccagcggagtaaccaagcaggttattgacacattccgccacgcc
tatggcagcaacctcagccctgagcagcgccaaggactcagcctgatcacccggcgcgaa
atggatgtactactgcgcgttgcacaagggctcaccaacgcggagatcagtgctgacctt
gggattgcagaaacgaccgtcaaaacgcatatcaccgcactgttagcaaaggtgcatgcc
cgtgaccgtgtcgctttggtgttgtttgcacataaagctgggcttctcctaccacggtag

DBGET integrated database retrieval system