KEGG   Corynebacterium diphtheriae INCA 402: CDB402_0059Help
Entry
CDB402_0059       CDS       T01688                                 

Definition
(GenBank) hypothetical protein
Organism
cdh  Corynebacterium diphtheriae INCA 402
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEX45371
Position
63409..63699
Genome map
AA seq 96 aa AA seqDB search
MTHVVHENHTHQHGPNCGHVAVPHGDHVDYVHDGHLHREHDGHWDECETSEHHTHADHEH
QHGPSCGHVAVPHGDHVDYIHDGHRHALHDGHWDDH
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgtagttcacgagaaccacacccaccagcacggcccgaactgtggccatgtg
gcagttcctcacggcgaccacgttgactatgttcacgacggccacctgcaccgcgagcat
gacggccactgggatgagtgtgaaacctccgagcatcacacccacgccgaccatgagcac
cagcatggcccaagttgcggtcacgtagcagttcctcacggcgaccacgttgactacatt
cacgacggccaccgccacgcactgcatgacggccactgggatgaccactaa

DBGET integrated database retrieval system